|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1Z67) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1Z67) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1Z67) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1Z67) |
Exons (0, 0)| (no "Exon" information available for 1Z67) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:127 aligned with Q83IZ7_SHIFL | Q83IZ7 from UniProtKB/TrEMBL Length:132 Alignment length:129 12 22 32 42 52 62 72 82 92 102 112 122 Q83IZ7_SHIFL 3 LFDEVVGAFLKGDAGKYQAILSWVEEQGGIQVLLEKLQSGGLGAILSTWLSNQQRNQSVSGEQLESALGTNAVSDLGQKLGVDTSTASSLLAEQLPKIIDALSPQGEVSAQANNDLLSAGMELLKGKLF 131 SCOP domains d1z67a1 A:3-131 Hypothetical protein YidB SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains DUF937-1z67A01 A:3-107 ------------------------ Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript 1z67 A 3 LFDEVVGAFLKGDAGKYQAILSWVEEQGGIQVLLEKLQSGGLGAILSTWLSNQQRNQSVSGEQLESALGTNAVSDLGQKLGVDTSTASSLLAEQLPKIIDALSPQGEV--QANNDLLSAGmELLKGKLF 131 12 22 32 42 52 62 72 82 92 102 | -| 122| 110 | 123-MSE 113
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1Z67) |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1Z67)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|