Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THE RESPONSE REGULATOR TORI BELONGS TO A NEW FAMILY OF ATYPICAL EXCISIONASE
 
Authors :  L. Elantak, M. Ansaldi, F. Guerlesquin, V. Mejean, X. Morelli
Date :  16 Mar 05  (Deposition) - 09 Aug 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (17x)
Keywords :  Winged Helix, Reverse Turn, Protein Binding, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Elantak, M. Ansaldi, F. Guerlesquin, V. Mejean, X. Morelli
Structural And Genetic Analyses Reveal A Key Role In Prophage Excision For The Tori Response Regulator Inhibitor
J. Biol. Chem. V. 280 36802 2005
PubMed-ID: 16079126  |  Reference-DOI: 10.1074/JBC.M507409200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TOR INHIBITION PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPETSI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    SynonymTORI

 Structural Features

(-) Chains, Units

  
NMR Structure (17x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1Z4H)

(-) Sites  (0, 0)

(no "Site" information available for 1Z4H)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1Z4H)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1Z4H)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1Z4H)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1Z4H)

(-) Exons   (0, 0)

(no "Exon" information available for 1Z4H)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:66
 aligned with TORI_ECOLI | Q2EES9 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:66
                                    10        20        30        40        50        60      
            TORI_ECOLI    1 MQHELQPDSLVDLKFIMADTGFGKTFIYDRIKSGDLPKAKVIHGRARWLYRDHCEFKNKLLSRANG 66
               SCOP domains ------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains -------Phage_AlpA-1z4hA01 A:8-52                    -------------- Pfam domains
         Sec.struct. author .........eehhhhhhhhhh.hhhhhhhhhhhhhh...ee....eeeehhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1z4h A  1 MQHELQPDSLVDLKFIMADTGFGKTFIYDRIKSGDLPKAKVIHGRARWLYRDHCEFKNKLLSRANG 66
                                    10        20        30        40        50        60      

Chain A from PDB  Type:PROTEIN  Length:66
 aligned with VXIS_BPHK6 | Q9AZ38 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:66
                                    10        20        30        40        50        60      
            VXIS_BPHK6    1 MQHELQPDSLVDLKFIMADTGFGKTFIYDRIKSGDLPKAKVIHGRARWLYRDHCEFKNKLLSRANG 66
               SCOP domains ------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains -------Phage_AlpA-1z4hA01 A:8-52                    -------------- Pfam domains
         Sec.struct. author .........eehhhhhhhhhh.hhhhhhhhhhhhhh...ee....eeeehhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1z4h A  1 MQHELQPDSLVDLKFIMADTGFGKTFIYDRIKSGDLPKAKVIHGRARWLYRDHCEFKNKLLSRANG 66
                                    10        20        30        40        50        60      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1Z4H)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1Z4H)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: HTH (544)

(-) Gene Ontology  (9, 11)

NMR Structure(hide GO term definitions)
Chain A   (TORI_ECOLI | Q2EES9)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
biological process
    GO:0044349    DNA excision    The removal of a section of DNA from a larger DNA molecule by the making of dual incisions that flank the section to be excised.
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:2000143    negative regulation of DNA-templated transcription, initiation    Any process that stops, prevents, or reduces the frequency, rate or extent of DNA-templated transcription initiation.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

Chain A   (VXIS_BPHK6 | Q9AZ38)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1z4h)
 
  Sites
(no "Sites" information available for 1z4h)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1z4h)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1z4h
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TORI_ECOLI | Q2EES9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  VXIS_BPHK6 | Q9AZ38
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TORI_ECOLI | Q2EES9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  VXIS_BPHK6 | Q9AZ38
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1Z4H)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1Z4H)