|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1YX3) |
(no "Site" information available for 1YX3) |
(no "SS Bond" information available for 1YX3) |
(no "Cis Peptide Bond" information available for 1YX3) |
(no "SAP(SNP)/Variant" information available for 1YX3) |
(no "PROSITE Motif" information available for 1YX3) |
(no "Exon" information available for 1YX3) |
NMR StructureChain A from PDB Type:PROTEIN Length:112 aligned with O87899_ALLVI | O87899 from UniProtKB/TrEMBL Length:112 Alignment length:112 10 20 30 40 50 60 70 80 90 100 110 O87899_ALLVI 1 MADTIEVDGKQFAVDEEGYLSNLNDWVPGVADVMAKQDNLELTEEHWDIINFLREYYEEYQIAPAVRVLTKAVGKKLGKEKGNSKYLYSLFPYGPAKQACRFAGLPKPTGCV 112 SCOP domains d1yx3a_ A: DsrC, the gamma subunit of dissimilatory sulfite reductase SCOP domains CATH domains -----------------------------------------1yx3A02 A:42-112 [code=1.10.10.370, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------- Transcript 1yx3 A 1 MADTIEVDGKQFAVDEEGYLSNLNDWVPGVADVMAKQDNLELTEEHWDIINFLREYYEEYQIAPAVRVLTKAVGKKLGKEKGNSKYLYSLFPYGPAKQACRFAGLPKPTGCV 112 10 20 30 40 50 60 70 80 90 100 110
|
NMR Structure |
NMR Structure
|
(no "Pfam Domain" information available for 1YX3) |
NMR Structure(hide GO term definitions) Chain A (O87899_ALLVI | O87899)
|
|
|
|
|
|
|