Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF DOMAIN OF UNKNOWN FUNCTION DUF77 FROM BACILLUS CEREUS
 
Authors :  Midwest Center For Structural Genomics (Mcsg)
Date :  01 Feb 05  (Deposition) - 15 Mar 05  (Release) - 01 Feb 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Bacillus Cereus, Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. E. Cuff, P. Quartey, M. Zhou, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Structure Of Domain Of Unknown Function Duf77 From Bacillus Cereus
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - IG HYPOTHETICAL 16092
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPMCSG7
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    GeneIG HYPOTHETICAL 16092
    Organism ScientificBACILLUS CEREUS ATCC 14579
    Organism Taxid226900
    StrainATCC 14579 / DSM 31
    SynonymDUF77

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric Unit (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1YQH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YQH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1YQH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1YQH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1YQH)

(-) Exons   (0, 0)

(no "Exon" information available for 1YQH)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:104
 aligned with Q81IG4_BACCR | Q81IG4 from UniProtKB/TrEMBL  Length:106

    Alignment length:104
                               1                                                                                                    
                               |     7        17        27        37        47        57        67        77        87        97    
         Q81IG4_BACCR     - ---MSQQVTMSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAMETTLEGELDVLLDVVKRAQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYA 101
               SCOP domains ---d1yqha1 A:1-101 Hypothetical protein BC0424                                                           SCOP domains
               CATH domains 1yqhA00 A:-2-101  [code=3.30.70.930, no name defined]                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeeeee....hhhhhhhhhhhhhhhh..eeee....eeeeehhhhhhhhhhhhhhhhhhh...eeeeeeeee.......hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 1yqh A  -2 SNAmSQQVTmSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAmETTLEGELDVLLDVVKRAQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYA 101
                               |     7        17        27        37     |  47        57        67        77        87        97    
                               |     7-MSE                              43-MSE                                                      
                               1-MSE                                                                                                

Chain B from PDB  Type:PROTEIN  Length:101
 aligned with Q81IG4_BACCR | Q81IG4 from UniProtKB/TrEMBL  Length:106

    Alignment length:101
                                    10        20        30        40        50        60        70        80        90       100 
         Q81IG4_BACCR     1 MSQQVTMSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAMETTLEGELDVLLDVVKRAQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYA 101
               SCOP domains d1yqhb_ B: automated matches                                                                          SCOP domains
               CATH domains -1yqhB00 B:2-101  [code=3.30.70.930, no name defined]                                                 CATH domains
           Pfam domains (1) ------DUF77-1yqhB01 B:7-97                                                                       ---- Pfam domains (1)
           Pfam domains (2) ------DUF77-1yqhB02 B:7-97                                                                       ---- Pfam domains (2)
         Sec.struct. author ...eeeeeeeeeee....hhhhhhhhhhhhhhhhh.eeee....eeeeeehhhhhhhhhhhhhhhhhh...eeeeeeeee.......hhhhhhh..hhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 1yqh B   1 mSQQVTmSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAmETTLEGELDVLLDVVKRAQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYA 101
                            |     | 10        20        30        40  |     50        60        70        80        90       100 
                            1-MSE 7-MSE                              43-MSE                                                      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1YQH)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1yqh)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1yqh)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1yqh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81IG4_BACCR | Q81IG4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q81IG4_BACCR | Q81IG4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1YQH)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1YQH)