Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL GENOMICS OF CAENORHABDITIS ELEGANS: GLUTATHIONE S-TRANSFERASE
 
Authors :  Southeast Collaboratory For Structural Genomics (Secsg)
Date :  31 Jan 05  (Deposition) - 15 Feb 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A,B  (2x)
Keywords :  Glutathione S-Transferase; Nematoda, Structural Genomics, Psi, Protein Structure Initiative, Southeast Collaboratory For Structural Genomics, Secsg (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Lu, N. Schorman, Y. Zhang, J. Symersky, J. An, A. Arabshahi, R. Bunzel, Z. Cao, M. Carson, Y. Chen, L. Delucas, R. Gray, W. Huang, D. Johnson, E. Karpova, S. Li, G. Lin, D. Luo, A. Mckinstry, S. Qiu, Q. Shang, M. Stinnett, J. Tsao, Q. Zhou, Q. -H. Luan, M. Luo
Structural Genomics Of Caenorhabditis Elegans: Glutathione S-Transferase
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE
    Chains: A, B
    EC Number: 2.5.1.18
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28B
    Expression System Strain: BL21 AI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: GST-16
    Organism Scientific: CAENORHABDITIS ELEGANS
    Organism Taxid: 6239

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): AB
Biological Unit 2 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric Unit (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1YQ1)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YQ1)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Leu A:52 -Pro A:53
2Leu B:52 -Pro B:53

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1YQ1)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1YQ1)

(-) Exons   (0, 0)

(no "Exon" information available for 1YQ1)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:201
 aligned with Q93698_CAEEL | Q93698 from UniProtKB/TrEMBL  Length:208

    Alignment length:205
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200     
         Q93698_CAEEL     1 MPSYKLTYFFFRGLGEPIRLLFHLAGVQFEEVRMNPDQTWLDIKDSTPMKQLPVLNIDGFELPQSGAILRYLARKFGFAGKTPEEEAWVDAVHDLFKDFLAEFKKFAAERRSGKSAEEVEKFRSEFFLPARNTYFNILNGLLEKSNSGFLIGSDITFADLVVVDNLLTLKNYGLFDESEFTKLAALREKVNSYPGIKEYIAKRPV 205
               SCOP domains d1yq1a1 A:1-78 automated matches                                              d1yq1a2 A:79-205 automated matches                                                                                              SCOP domains
               CATH domains -1yq1A01 A:2-76,A:193-205 Glutaredoxin                                      --------------------------------------------------------------------------------------------------------------------1yq1A01       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.....hhhhhhhhhhhh...eeeee.....hhhhhhh.......eeee...ee.hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...----..hhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh..hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yq1 A   1 mPSYKLTYFFFRGLGEPIRLLFHLAGVQFEEVRmNPDQTWLDIKDSTPmKQLPVLNIDGFELPQSGAILRYLARKFGFAGKTPEEEAWVDAVHDLFKDFLAEFKKFAAERRSG----EVEKFRSEFFLPARNTYFNILNGLLEKSNSGFLIGSDITFADLVVVDNLLTLKNYGLFDESEFTKLAALREKVNSYPGIKEYIAKRPV 205
                            |       10        20        30   |    40        50        60        70        80        90       100       110  |    120       130       140       150       160       170       180       190       200     
                            |                               34-MSE         49-MSE                                                         113  118                                                                                       
                            1-MSE                                                                                                                                                                                                        


Chain B from PDB  Type:PROTEIN  Length:201
 aligned with Q93698_CAEEL | Q93698 from UniProtKB/TrEMBL  Length:208

    Alignment length:205
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200     
         Q93698_CAEEL     1 MPSYKLTYFFFRGLGEPIRLLFHLAGVQFEEVRMNPDQTWLDIKDSTPMKQLPVLNIDGFELPQSGAILRYLARKFGFAGKTPEEEAWVDAVHDLFKDFLAEFKKFAAERRSGKSAEEVEKFRSEFFLPARNTYFNILNGLLEKSNSGFLIGSDITFADLVVVDNLLTLKNYGLFDESEFTKLAALREKVNSYPGIKEYIAKRPV 205
               SCOP domains d1yq1b1 B:1-78 automated matches                                              d1yq1b2 B:79-205 automated matches                                                                                              SCOP domains
               CATH domains -1yq1B01 B:2-76,B:193-205 Glutaredoxin                                      --------------------------------------------------------------------------------------------------------------------1yq1B01       CATH domains
           Pfam domains (1) ---GST_N-1yq1B03 B:4-74                                                   -----------GST_C-1yq1B01 B:86-194                                                                                       ----------- Pfam domains (1)
           Pfam domains (2) ---GST_N-1yq1B04 B:4-74                                                   -----------GST_C-1yq1B02 B:86-194                                                                                       ----------- Pfam domains (2)
         Sec.struct. author ...eeeeee.....hhhhhhhhhhh...eeeeee.....hhhhhh........eeee..eeeehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh.....----.....hhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh..hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yq1 B   1 mPSYKLTYFFFRGLGEPIRLLFHLAGVQFEEVRmNPDQTWLDIKDSTPmKQLPVLNIDGFELPQSGAILRYLARKFGFAGKTPEEEAWVDAVHDLFKDFLAEFKKFAAERRSG----EVEKFRSEFFLPARNTYFNILNGLLEKSNSGFLIGSDITFADLVVVDNLLTLKNYGLFDESEFTKLAALREKVNSYPGIKEYIAKRPV 205
                            |       10        20        30   |    40        50        60        70        80        90       100       110  |    120       130       140       150       160       170       180       190       200     
                            1-MSE                           34-MSE         49-MSE                                                         113  118
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 4)

Asymmetric Unit
(-)
Clan: GST_C (118)
(-)
Clan: Thioredoxin (367)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q93698_CAEEL | Q93698)
molecular function
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1yq1)
 
  Cis Peptide Bonds
    Leu A:52 - Pro A:53   [ RasMol ]  
    Leu B:52 - Pro B:53   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1yq1
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q93698_CAEEL | Q93698
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.18
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q93698_CAEEL | Q93698
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1YQ1)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1YQ1)