|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1YLQ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1YLQ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1YLQ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1YLQ) |
Exons (0, 0)| (no "Exon" information available for 1YLQ) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:93 aligned with O29641_ARCFU | O29641 from UniProtKB/TrEMBL Length:93 Alignment length:93 1 | 7 17 27 37 47 57 67 77 87 O29641_ARCFU - ---MKEIKEITKKDVQDAEIYLYGSVVEGDYSIGLSDIDVAIVSDVFEDRNRKLEFFGKITKKFFDSPFEFHILTKKEWKMSKRFIRKYRRLD 90 SCOP domains ---d1ylqa1 A:1-90 Putative nucleotidyltransferase AF0614 SCOP domains CATH domains 1ylqA00 A:-2-90 Beta Polymerase, domain 2 CATH domains Pfam domains --------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------- Transcript 1ylq A -2 AGHMKEIKEITKKDVQDAEIYLYGSVVEGDYSIGLSDIDVAIVSDVFEDRNRKLEFFGKITKKFFDSPFEFHILTKKEWKMSKRFIRKYRRLD 90 7 17 27 37 47 57 67 77 87 Chain B from PDB Type:PROTEIN Length:93 aligned with O29641_ARCFU | O29641 from UniProtKB/TrEMBL Length:93 Alignment length:93 1 | 7 17 27 37 47 57 67 77 87 O29641_ARCFU - ---MKEIKEITKKDVQDAEIYLYGSVVEGDYSIGLSDIDVAIVSDVFEDRNRKLEFFGKITKKFFDSPFEFHILTKKEWKMSKRFIRKYRRLD 90 SCOP domains d1ylqb_ B: automated matches SCOP domains CATH domains 1ylqB00 B:-2-90 Beta Polymerase, domain 2 CATH domains Pfam domains (1) ---NTP_transf_2-1ylqB01 B:1-90 Pfam domains (1) Pfam domains (2) ---NTP_transf_2-1ylqB02 B:1-90 Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------- Transcript 1ylq B -2 AGHMKEIKEITKKDVQDAEIYLYGSVVEGDYSIGLSDIDVAIVSDVFEDRNRKLEFFGKITKKFFDSPFEFHILTKKEWKMSKRFIRKYRRLD 90 7 17 27 37 47 57 67 77 87
|
||||||||||||||||||||
SCOP Domains (2, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (1, 2)| Asymmetric/Biological Unit |
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (O29641_ARCFU | O29641)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|