Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PUTATIVE NUCLEOTIDYLTRANSFERASE
 
Authors :  C. Chang, A. Joachimiak, T. Skarina, A. Savchenko, Midwest Center Fo Structural Genomics (Mcsg)
Date :  19 Jan 05  (Deposition) - 01 Mar 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.02
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Nucleotidyltransferase, Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Chang, A. Joachimiak, T. Skarina, A. Edwards, A. Savchenko
Crystal Structure Of Hypothetical Protein Af0614, Putative Nucleotidyltransferase
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE NUCLEOTIDYLTRANSFERASE, HYPOTHETICAL PROTEIN AF0614
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificARCHAEOGLOBUS FULGIDUS
    Organism Taxid2234

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1SO42Ligand/IonSULFATE ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:32 , SER A:33 , ASP A:36 , ARG A:47 , ASN A:48 , GLU A:67 , HOH A:222 , HOH A:240BINDING SITE FOR RESIDUE SO4 A 201
2AC2SOFTWARELEU B:32 , SER B:33 , ASP B:36 , ARG B:47 , ASN B:48 , GLU B:67 , HOH B:223 , HOH B:240BINDING SITE FOR RESIDUE SO4 B 202

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YLQ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1YLQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1YLQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1YLQ)

(-) Exons   (0, 0)

(no "Exon" information available for 1YLQ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:93
 aligned with O29641_ARCFU | O29641 from UniProtKB/TrEMBL  Length:93

    Alignment length:93
                               1                                                                                         
                               |     7        17        27        37        47        57        67        77        87   
          O29641_ARCFU    - ---MKEIKEITKKDVQDAEIYLYGSVVEGDYSIGLSDIDVAIVSDVFEDRNRKLEFFGKITKKFFDSPFEFHILTKKEWKMSKRFIRKYRRLD 90
               SCOP domains ---d1ylqa1 A:1-90 Putative nucleotidyltransferase AF0614                                      SCOP domains
               CATH domains 1ylqA00 A:-2-90 Beta Polymerase, domain 2                                                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh...eeeeehhhhhh........eeeeee.hhhhhhhhhhhhhhhhhhhh....eeeeeehhhhhhhhhh.....ee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                  1ylq A -2 AGHMKEIKEITKKDVQDAEIYLYGSVVEGDYSIGLSDIDVAIVSDVFEDRNRKLEFFGKITKKFFDSPFEFHILTKKEWKMSKRFIRKYRRLD 90
                                     7        17        27        37        47        57        67        77        87   

Chain B from PDB  Type:PROTEIN  Length:93
 aligned with O29641_ARCFU | O29641 from UniProtKB/TrEMBL  Length:93

    Alignment length:93
                               1                                                                                         
                               |     7        17        27        37        47        57        67        77        87   
          O29641_ARCFU    - ---MKEIKEITKKDVQDAEIYLYGSVVEGDYSIGLSDIDVAIVSDVFEDRNRKLEFFGKITKKFFDSPFEFHILTKKEWKMSKRFIRKYRRLD 90
               SCOP domains d1ylqb_ B: automated matches                                                                  SCOP domains
               CATH domains 1ylqB00 B:-2-90 Beta Polymerase, domain 2                                                     CATH domains
           Pfam domains (1) ---NTP_transf_2-1ylqB01 B:1-90                                                                Pfam domains (1)
           Pfam domains (2) ---NTP_transf_2-1ylqB02 B:1-90                                                                Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhh...eeeeehhhhhh........eeeeee.hhhhhhhhhhhhhhhhhhhh....eeeeeehhhhhhhhhh.....ee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                  1ylq B -2 AGHMKEIKEITKKDVQDAEIYLYGSVVEGDYSIGLSDIDVAIVSDVFEDRNRKLEFFGKITKKFFDSPFEFHILTKKEWKMSKRFIRKYRRLD 90
                                     7        17        27        37        47        57        67        77        87   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (O29641_ARCFU | O29641)
molecular function
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ylq)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ylq
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O29641_ARCFU | O29641
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  O29641_ARCFU | O29641
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1YLQ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1YLQ)