|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric Unit (3, 3) Biological Unit 1 (3, 6) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1YEB) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1YEB) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1YEB) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:108 aligned with CYC7_YEAST | P00045 from UniProtKB/Swiss-Prot Length:113 Alignment length:108 15 25 35 45 55 65 75 85 95 105 CYC7_YEAST 6 TGFKPGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWDEDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKAAK 113 SCOP domains d1yeba_ A: Mitochondrial cytochrome c SCOP domains CATH domains 1yebA00 A:-5-103 Cytochrome c CATH domains Pfam domains -------Cytochrom_C-1yebA01 A:3-97 ------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE -----CYTC PDB: A:1-101 UniProt: 11-112 - PROSITE Transcript 1 Exon 1.1 PDB: A:-5-103 UniProt: 1-113 [INCOMPLETE] Transcript 1 1yeb A -5 TEFKAGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWDEDSMSEYLTNPkKYIPGTKMAFGGLKKEKDRNDLITYLKKACE 103 || 5 15 25 35 45 55 65 | 75 85 95 -1| 72-M3L 1
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (9, 9)|
Asymmetric Unit(hide GO term definitions) Chain A (CYC7_YEAST | P00045)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||||||||||||||||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|