|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (2, 4) Biological Unit 2 (2, 8) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1YB3) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1YB3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1YB3) |
Exons (0, 0)| (no "Exon" information available for 1YB3) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:166 aligned with Q8U4C0_PYRFU | Q8U4C0 from UniProtKB/TrEMBL Length:167 Alignment length:166 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 Q8U4C0_PYRFU 2 MLKEVHELLNRIWGDIFELREELKEELKGFTVEEVSEVFNAYLYIDGKWEEMKYPHPAFAVKPGGEVGATPQGFYFVFAFPKEELSKEFIEDVIRAFEKLFIYGAENFLEDFYNFEHPISGDEVWDRIVNSDEEMINFEVDLGFDKEEVKREIKRFIELARRYNLL 167 SCOP domains d1yb3a1 A:2-167 Hypothetical protein PF0168 SCOP domains CATH domains -1yb3A00 A:3-167 Bira Bifunctional Protein; Domain 2 CATH domains Pfam domains ------DUF3201-1yb3A01 A:8-157 ---------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1yb3 A 2 mLKEVHELLNRIWGDIFELREELKEELKGFTVEEVSEVFNAYLYIDGKWEEmKYPHPAFAVKPGGEVGATPQGFYFVFAFPKEELSKEFIEDVIRAFEKLFIYGAENFLEDFYNFEHPISGDEVWDRIVNSDEEmINFEVDLGFDKEEVKREIKRFIELARRYNLL 167 | 11 21 31 41 51 | 61 71 81 91 101 111 121 131 | 141 151 161 | 53-MSE 136-MSE 2-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1YB3)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|