Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  THE 1.8 ANGSTROM CRYSTAL STRUCTURE OF THE YCAC GENE PRODUCT FROM ESCHERICHIA COLI REVEALS AN OCTAMERIC HYDROLASE OF UNKNOWN SPECIFICITY
 
Authors :  C. Colovos, D. Cascio, T. O. Yeates
Date :  29 Jul 98  (Deposition) - 16 Feb 99  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (4x)
Keywords :  Unknown Bacterial Hydrolase, Three Layer Alpha-Beta-Alpha Sandwich Topology, Entb Homolog, Cshase Homolog (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Colovos, D. Cascio, T. O. Yeates
The 1. 8 A Crystal Structure Of The Ycac Gene Product From Escherichia Coli Reveals An Octameric Hydrolase Of Unknown Specificity.
Structure V. 6 1329 1998
PubMed-ID: 9782055  |  Reference-DOI: 10.1016/S0969-2126(98)00132-4

(-) Compounds

Molecule 1 - YCAC GENE PRODUCT
    Chains: A, B
    Engineered: YES
    Gene: YCAC
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
    Synonym: YCACGP

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (4x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1YAC)

(-) Sites  (0, 0)

(no "Site" information available for 1YAC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1YAC)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Val A:113 -Val A:114
2Val B:113 -Val B:114

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1YAC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1YAC)

(-) Exons   (0, 0)

(no "Exon" information available for 1YAC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:204
 aligned with YCAC_ECOLI | P21367 from UniProtKB/Swiss-Prot  Length:208

    Alignment length:204
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201    
           YCAC_ECOLI     2 TKPYVRLDKNDAAVLLVDHQAGLLSLVRDIEPDKFKNNVLALGDLAKYFNLPTILTTSFETGPNGPLVPELKAQFPDTPYIARPGNINAWDNEDFVKAVKATGKKQLIIAGVVTEVCVAFPALSAIEEGFDVFVVTDASGTFNEITRHSAWDRLSQAGAQLMTWFGVACELHRDWRNDIEGLATLFSNHIPDYRNLMTSYDTLT 205
               SCOP domains d1yaca_ A: YcaC                                                                                                                                                                                              SCOP domains
               CATH domains 1yacA00 A:2-205  [code=3.40.50.850, no name defined]                                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........eeeeee.....hhhh.....hhhhhhhhhhhhhhhhh....eeeeee..........hhhhhh....eeeee.....hhh.hhhhhhhhhh...eeeeee.......hhhhhhhhh...eeeee........hhhhhhhhhhhhhh..eee.hhhhhhhhh..hhh.hhhhhhhhhhh.hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1yac A   2 TKPYVRLDKNDAAVLLVDHQAGLLSLVRDIEPDKFKNNVLALGDLAKYFNLPTILTTSAETGPNGPLVPELKAQFPDAPYIARPGNINAWDNEDFVKAVKATGKKQLIIAGVVTEVCVAFPALSAIEEGFDVFVVTDASGTFNEITRHSAWDRMSQAGAQLMTWFGVACELHRDWRNDIAGLATLFSNHIPDYRNLMTSYDTLT 205
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201    


Chain B from PDB  Type:PROTEIN  Length:204
 aligned with YCAC_ECOLI | P21367 from UniProtKB/Swiss-Prot  Length:208

    Alignment length:204
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201    
           YCAC_ECOLI     2 TKPYVRLDKNDAAVLLVDHQAGLLSLVRDIEPDKFKNNVLALGDLAKYFNLPTILTTSFETGPNGPLVPELKAQFPDTPYIARPGNINAWDNEDFVKAVKATGKKQLIIAGVVTEVCVAFPALSAIEEGFDVFVVTDASGTFNEITRHSAWDRLSQAGAQLMTWFGVACELHRDWRNDIEGLATLFSNHIPDYRNLMTSYDTLT 205
               SCOP domains d1yacb_ B: YcaC                                                                                                                                                                                              SCOP domains
               CATH domains 1yacB00 B:2-205  [code=3.40.50.850, no name defined]                                                                                                                                                         CATH domains
           Pfam domains (1) -----------Isochorismatase-1yacB01 B:13-166                                                                                                                          --------------------------------------- Pfam domains (1)
           Pfam domains (2) -----------Isochorismatase-1yacB02 B:13-166                                                                                                                          --------------------------------------- Pfam domains (2)
         Sec.struct. author ...........eeeeee.....hhhh.....hhhhhhhhhhhhhhhhh...eeeeeee..........hhhhhh....eeeee.....hhh.hhhhhhhhhh...eeeeee.......hhhhhhhhh...eeeee........hhhhhhhhhhhhhh..eee.hhhhhhhhh..hhh.hhhhhhhhhhh.hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1yac B   2 TKPYVRLDKNDAAVLLVDHQAGLLSLVRDIEPDKFKNNVLALGDLAKYFNLPTILTTSAETGPNGPLVPELKAQFPDAPYIARPGNINAWDNEDFVKAVKATGKKQLIIAGVVTEVCVAFPALSAIEEGFDVFVVTDASGTFNEITRHSAWDRMSQAGAQLMTWFGVACELHRDWRNDIAGLATLFSNHIPDYRNLMTSYDTLT 205
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: no clan defined [family: Isochorismatase] (9)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (YCAC_ECOLI | P21367)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1yac)
 
  Sites
(no "Sites" information available for 1yac)
 
  Cis Peptide Bonds
    Val A:113 - Val A:114   [ RasMol ]  
    Val B:113 - Val B:114   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1yac
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  YCAC_ECOLI | P21367
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  YCAC_ECOLI | P21367
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1YAC)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1YAC)