Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  1H NMR STRUCTURE OF ACYLPHOSPHATASE FROM THE HYPERTHERMOPHILE SULFOLOBUS SOLFATARICUS
 
Authors :  A. Corazza, C. Rosano, K. Pagano, V. Alverdi, G. Esposito, C. Capanni, F. Bemporad, G. Plakoutsi, M. Stefani, F. Chiti, S. Zuccotti, M. Bolognesi, P. Viglino
Date :  16 Dec 04  (Deposition) - 29 Nov 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Sso, Acylphosphatase, Hyperthermophile, Nmr, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Corazza, C. Rosano, K. Pagano, V. Alverdi, G. Esposito, C. Capanni, F. Bemporad, G. Plakoutsi, M. Stefani, F. Chiti, S. Zuccotti, M. Bolognesi, P. Viglino
Structure, Conformational Stability, And Enzymatic Properties Of Acylphosphatase From The Hyperthermophile Sulfolobus Solfataricus
Proteins V. 62 64 2006
PubMed-ID: 16287076  |  Reference-DOI: 10.1002/PROT.20703
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ACYLPHOSPHATASE
    Chains: A
    EC Number: 3.6.1.7
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PGEX-2T
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: SULFOLOBUS SOLFATARICUS
    Organism Taxid: 2287

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1Y9O)

(-) Sites  (0, 0)

(no "Site" information available for 1Y9O)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1Y9O)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1Y9O)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1Y9O)

(-) PROSITE Motifs  (3, 3)

NMR Structure (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ACYLPHOSPHATASE_3PS51160 Acylphosphatase-like domain profile.ACYP_SULSO15-101  1A:15-101
2ACYLPHOSPHATASE_1PS00150 Acylphosphatase signature 1.ACYP_SULSO20-30  1A:20-30
3ACYLPHOSPHATASE_2PS00151 Acylphosphatase signature 2.ACYP_SULSO44-60  1A:44-60

(-) Exons   (0, 0)

(no "Exon" information available for 1Y9O)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:103
 aligned with ACYP_SULSO | Q97ZL0 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:103
                              1                                                                                                    
                              |      8        18        28        38        48        58        68        78        88        98   
           ACYP_SULSO     - --MKKWSDTEVFEMLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDYSFSEYKGEFEDFETY 101
               SCOP domains d1y9oa_ A: automated matches                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------Acylphosphatase-1y9oA01 A:12-101                                                           Pfam domains
         Sec.struct. author ...............eeeeeee.......hhhhhhhhhhhhh...eeee......eeeeeee.hhhhhhhhhhhhhh.........eeee.........eee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------ACYLPHOSPHATASE_3  PDB: A:15-101 UniProt: 15-101                                        PROSITE (1)
                PROSITE (2) ---------------------ACYLPHOSPHA-------------ACYLPHOSPHATASE_2----------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 1y9o A  -1 GSMKKWSDTEVFEMLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDYSFSEYKGEFEDFETY 101
                                     8        18        28        38        48        58        68        78        88        98
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1Y9O)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Acylphosphatase] (11)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (ACYP_SULSO | Q97ZL0)
molecular function
    GO:0003998    acylphosphatase activity    Catalysis of the reaction: an acyl phosphate + H2O = a carboxylate + phosphate.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1y9o)
 
  Sites
(no "Sites" information available for 1y9o)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1y9o)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1y9o
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACYP_SULSO | Q97ZL0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.6.1.7
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ACYP_SULSO | Q97ZL0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ACYP_SULSO | Q97ZL0: 2bjd 2bje 4oix 4oj1 4oj3 4ojg 4ojh

(-) Related Entries Specified in the PDB File

8393