Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  X-RAY STRUCTURE OF GENE PRODUCT FROM ARABIDOPSIS THALIANA AT2G19940
 
Authors :  G. E. Wesenberg, G. N. Phillips Jr. , E. Bitto, C. A. Bingman, S. T. M. All Center For Eukaryotic Structural Genomics (Cesg)
Date :  09 Nov 04  (Deposition) - 23 Nov 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.19
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Structural Genomics, Protein Structure Initiative, Psi, Center For Eukaryotic Structural Genomics, Cesg, At2G19940, Cath 3. 40. 50 Fold, Semialdehyde Dehydorgenase Family, Tetramer, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Center For Eukaryotic Structural Genomics
X-Ray Structure Of Gene Product From Arabidopsis Thaliana At2G19940
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPVP-17
    Expression System StrainB834 P(RARE2)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneAT2G19940
    Organism CommonTHALE CRESS
    Organism ScientificARABIDOPSIS THALIANA
    Organism Taxid3702

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1XYG)

(-) Sites  (0, 0)

(no "Site" information available for 1XYG)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XYG)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Phe A:358 -Pro A:359
2Phe B:358 -Pro B:359
3Phe C:358 -Pro C:359
4Phe D:358 -Pro D:359

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XYG)

(-) PROSITE Motifs  (1, 4)

Asymmetric/Biological Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ARGCPS01224 N-acetyl-gamma-glutamyl-phosphate reductase active site.ARGC_ARATH200-216
 
 
 
  4A:158-174
B:158-174
C:158-174
D:158-174

(-) Exons   (0, 0)

(no "Exon" information available for 1XYG)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:345
 aligned with ARGC_ARATH | Q93Z70 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:345
                                    66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396     
           ARGC_ARATH    57 KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401
               SCOP domains d1xyga1 A:15-162,A:327-359 N-acetyl-gamma-glutamyl-phosphate reductase ArgC                                                                         d1xyga2 A:163-326 N-acetyl-gamma-glutamyl-phosphate reductase ArgC                                                                                                  d1xyga1 A:15-162,A:327-359        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------1xygA02 A:161-327 Dihydrodipicolinate Reductase; domain 2                                                                                                              -------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee...hhhhhhhhhhhhh...eeeeee........hhhhhhhhhh........hhhhhhhhhh.eeee.....hhhhhhhh.....eeee........hhhhhhhhhh....hhhhhh..ee.hhhhhhhhhhh..eee..hhhhhhhhhhhhhhhhh........eeeeeee.hhhh...hhhhhhhhhh...ee......hhhhhhhhhhhhhhh.....eee.eee.....eeeeeeee.....hhhhhhhhhhhhhh....eee.......hhhhh.....eeeeeee.....eeeeeeee......hhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------ARGC             ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xyg A  15 KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 359
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354     

Chain B from PDB  Type:PROTEIN  Length:345
 aligned with ARGC_ARATH | Q93Z70 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:345
                                    66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396     
           ARGC_ARATH    57 KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401
               SCOP domains d1xygb1 B:15-162,B:327-359 N-acetyl-gamma-glutamyl-phosphate reductase ArgC                                                                         d1xygb2 B:163-326 N-acetyl-gamma-glutamyl-phosphate reductase ArgC                                                                                                  d1xygb1 B:15-162,B:327-359        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------1xygB02 B:161-327 Dihydrodipicolinate Reductase; domain 2                                                                                                              -------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee...hhhhhhhhhhhhh...eeeeeee.......hhhhhhhhhh........hhhhhhhhhh.eeee.....hhhhhhhh.....eeee........hhhhhhhhhh....hhhhhh..ee.hhhhhhhhhhh..eee..hhhhhhhhhhhhhhhhh........eeeeeee.hhhh...hhhhhhhhhh...ee......hhhhhhhhhhhhhhh.....eee.eee.....eeeeeeee.....hhhhhhhhhhhhhh....eee.......hhhhh.....eeeeeee.....eeeeeeee......hhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------ARGC             ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xyg B  15 KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 359
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354     

Chain C from PDB  Type:PROTEIN  Length:345
 aligned with ARGC_ARATH | Q93Z70 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:345
                                    66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396     
           ARGC_ARATH    57 KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401
               SCOP domains d1xygc1 C:15-162,C:327-359 N-acetyl-gamma-glutamyl-phosphate reductase ArgC                                                                         d1xygc2 C:163-326 N-acetyl-gamma-glutamyl-phosphate reductase ArgC                                                                                                  d1xygc1 C:15-162,C:327-359        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------1xygC02 C:161-327 Dihydrodipicolinate Reductase; domain 2                                                                                                              -------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee...hhhhhhhhhhhhh...eeeeeee.hhhh..hhhhhhhhhh......ee...........eeee.....hhhhhhhh.....eeee........hhhhhhhhhh....hhhhhh..ee.hhhhhhhhhhh..eee..hhhhhhhhhhhhhhhhh........eeeeeee.hhhh...hhhhhhhhhh...ee......hhhhhhhhhhhhhhh.....eee.eee.....eeeeeeee.....hhhhhhhhhhhhhh....eee.......hhhhh.....eeeeeee.....eeeeeeee......hhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------ARGC             ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xyg C  15 KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 359
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354     

Chain D from PDB  Type:PROTEIN  Length:345
 aligned with ARGC_ARATH | Q93Z70 from UniProtKB/Swiss-Prot  Length:401

    Alignment length:345
                                    66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396     
           ARGC_ARATH    57 KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401
               SCOP domains d1xygd1 D:15-162,D:327-359 N-acetyl-gamma-glutamyl-phosphate reductase ArgC                                                                         d1xygd2 D:163-326 N-acetyl-gamma-glutamyl-phosphate reductase ArgC                                                                                                  d1xygd1 D:15-162,D:327-359        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------1xygD02 D:161-327 Dihydrodipicolinate Reductase; domain 2                                                                                                              -------------------------------- CATH domains
           Pfam domains (1) ---Semialdhyde_dh-1xygD05 D:18-155                                                                                                           ----------------Semialdhyde_dhC-1xygD01 D:172-330                                                                                                                              ----------------------------- Pfam domains (1)
           Pfam domains (2) ---Semialdhyde_dh-1xygD06 D:18-155                                                                                                           ----------------Semialdhyde_dhC-1xygD02 D:172-330                                                                                                                              ----------------------------- Pfam domains (2)
           Pfam domains (3) ---Semialdhyde_dh-1xygD07 D:18-155                                                                                                           ----------------Semialdhyde_dhC-1xygD03 D:172-330                                                                                                                              ----------------------------- Pfam domains (3)
           Pfam domains (4) ---Semialdhyde_dh-1xygD08 D:18-155                                                                                                           ----------------Semialdhyde_dhC-1xygD04 D:172-330                                                                                                                              ----------------------------- Pfam domains (4)
         Sec.struct. author ..eeeeee...hhhhhhhhhhhhh...eeeeeee.......hhhhhhhhhh........hhhhh......eeee.....hhhhhhhh.....eeee........hhhhhhhhhh....hhhhhh..ee.hhhhhhhhhhh..eee..hhhhhhhhhhhhhhhhh........eeeeeee.hhhh...hhhhhhhhhh...ee......hhhhhhhhhhhhhhh.....eee.eee.....eeeeeeee.....hhhhhhhhhhhhhh....eee.......hhhhh.....eeeeeee.....eeeeeeee......hhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------ARGC             ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xyg D  15 KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 359
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 8)

Asymmetric/Biological Unit

(-) Gene Ontology  (16, 16)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (ARGC_ARATH | Q93Z70)
molecular function
    GO:0003942    N-acetyl-gamma-glutamyl-phosphate reductase activity    Catalysis of the reaction: N-acetyl-L-glutamate 5-semialdehyde + NADP+ + phosphate = N-acetyl-5-glutamyl phosphate + NADPH + H+.
    GO:0051287    NAD binding    Interacting selectively and non-covalently with nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
    GO:0005507    copper ion binding    Interacting selectively and non-covalently with copper (Cu) ions.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016620    oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which an aldehyde or ketone (oxo) group acts as a hydrogen or electron donor and reduces NAD or NADP.
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
biological process
    GO:0006526    arginine biosynthetic process    The chemical reactions and pathways resulting in the formation of arginine, 2-amino-5-(carbamimidamido)pentanoic acid.
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0046686    response to cadmium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0009570    chloroplast stroma    The space enclosed by the double membrane of a chloroplast but excluding the thylakoid space. It contains DNA, ribosomes and some temporary products of photosynthesis.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0009536    plastid    Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1xyg)
 
  Sites
(no "Sites" information available for 1xyg)
 
  Cis Peptide Bonds
    Phe A:358 - Pro A:359   [ RasMol ]  
    Phe B:358 - Pro B:359   [ RasMol ]  
    Phe C:358 - Pro C:359   [ RasMol ]  
    Phe D:358 - Pro D:359   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xyg
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ARGC_ARATH | Q93Z70
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ARGC_ARATH | Q93Z70
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ARGC_ARATH | Q93Z702q49

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XYG)