Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF APAG PROTEIN FROM VIBRIO CHOLERAE
 
Authors :  C. Chang, A. Joachimiak, H. Li, Midwest Center For Structural Geno (Mcsg)
Date :  28 Oct 04  (Deposition) - 14 Dec 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.01
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Apag, Mcsg Apc26324, Midwest Center For Structural Genomics, Protein Structure Initiative, Psi, Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Chang, A. Joachimiak, H. Li, S. Moy, Midwest Center For Structural Genomics (Mcsg)
Crystal Structure Of Apag From Vibrio Cholerae
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PROTEIN APAG
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: APAG
    Organism Scientific: VIBRIO CHOLERAE
    Organism Taxid: 666

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 9)

Asymmetric/Biological Unit (2, 9)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2MSE8Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:27 , VAL A:29 , ALA A:88 , HOH A:305 , HOH A:324 , HOH A:384 , ARG B:27 , VAL B:29 , ALA B:88 , HOH B:139BINDING SITE FOR RESIDUE GOL A 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XVS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XVS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XVS)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1APAGPS51087 ApaG domain profile.APAG_VIBCH2-126
 		  2A:2-124
B:2-124

(-) Exons   (0, 0)

(no "Exon" information available for 1XVS)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:124
 aligned with APAG_VIBCH | Q9KUS3 from UniProtKB/Swiss-Prot  Length:126

    Alignment length:124
                                    10        20        30        40        50        60        70        80        90       100       110       120    
           APAG_VIBCH     1 MDVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLMSRRWLITDADGKQTVVEGDGVVGEQPRIKANDEYTYSSGTALDTPVGVMQGQYLMIDEQGESFTVEIEPFRLAVPHV 124
               SCOP domains d1xvsa_ A: ApaG                                                                                                              SCOP domains
               CATH domains -1xvsA00 A:2-124 Protein apag                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeeee.hhhhhhhhh.eeeeeeeeeee.....eeeeeeeeeeee....eeeeeee.......ee....eeeeeeeeee...eeeeeeeeeee.....eeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -APAG  PDB: A:2-124 UniProt: 2-126                                                                                           PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xvs A   1 mDVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLmSRRWLITDADGKQTVVEGDGVVGEQPRIKANDEYTYSSGTALDTPVGVmQGQYLmIDEQGESFTVEIEPFRLAVPHV 124
                            |       10        20        30        40      | 50        60        70        80        90     | 100 |     110       120    
                            |                                            47-MSE                                           96-MSE |                      
                            1-MSE                                                                                              102-MSE                  


Chain B from PDB  Type:PROTEIN  Length:124
 aligned with APAG_VIBCH | Q9KUS3 from UniProtKB/Swiss-Prot  Length:126

    Alignment length:124
                                    10        20        30        40        50        60        70        80        90       100       110       120    
           APAG_VIBCH     1 MDVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLMSRRWLITDADGKQTVVEGDGVVGEQPRIKANDEYTYSSGTALDTPVGVMQGQYLMIDEQGESFTVEIEPFRLAVPHV 124
               SCOP domains d1xvsb_ B: ApaG                                                                                                              SCOP domains
               CATH domains -1xvsB00 B:2-124 Protein apag                                                                                                CATH domains
           Pfam domains (1) ----------------DUF525-1xvsB01 B:17-106                                                                   ------------------ Pfam domains (1)
           Pfam domains (2) ----------------DUF525-1xvsB02 B:17-106                                                                   ------------------ Pfam domains (2)
         Sec.struct. author .......eeeeeeeee.hhhhhhhhh.eeeeeeeeeee.....eeeeeeeeeeee....eeeeeee.......ee....eeeeeeeeee...eeeeeeeeeee.....eeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -APAG  PDB: B:2-124 UniProt: 2-126                                                                                           PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xvs B   1 mDVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLmSRRWLITDADGKQTVVEGDGVVGEQPRIKANDEYTYSSGTALDTPVGVmQGQYLmIDEQGESFTVEIEPFRLAVPHV 124
                            |       10        20        30        40      | 50        60        70        80        90     | 100 |     110       120    
                            1-MSE                                        47-MSE                                           96-MSE |                      
                                                                                                                               102-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: DUF525] (3)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (APAG_VIBCH | Q9KUS3)
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xvs)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xvs
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  APAG_VIBCH | Q9KUS3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  APAG_VIBCH | Q9KUS3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1XVS)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XVS)