Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL ANALYSIS OF LEISHMANIA MAJOR LMAJ004091AAA, A SAM-DEPENDENT METHYLTRANSFERASE OF THE DUF858/PFAM05891 FAMILY
 
Authors :  M. A. Robien, W. G. J. Hol, Structural Genomics Of Pathogenic Proto Consortium (Sgpp)
Date :  22 Oct 04  (Deposition) - 09 Nov 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.94
Chains :  Asym./Biol. Unit :  A
Keywords :  Sgpp, Structural Genomics, Psi, Protein Structure Initiative, Sam- Dependent Methyltransferase, Structural Genomics Of Pathogenic Protozoa Consortium, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. A. Robien, W. G. J. Hol, Structural Genomics Of Pathogenic Protozoa Consortium
Structural Analysis Of Leishmania Major Lmaj004091Aaa
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - LMAJ004091AAA
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET14B
    Expression System Strain: BL21STAR(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: T7 SYSTEM
    Gene: LMJF30.0810
    Organism Scientific: LEISHMANIA MAJOR
    Organism Taxid: 347515
    Strain: FRIEDLIN

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric/Biological Unit (2, 8)
No.NameCountTypeFull Name
1MSE7Mod. Amino AcidSELENOMETHIONINE
2SAI1Ligand/IonS-ADENOSYL-L-HOMOSELENOCYSTEINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:57 , VAL A:67 , GLY A:101 , ALA A:102 , GLY A:103 , ARG A:106 , ILE A:107 , GLU A:123 , PRO A:124 , VAL A:125 , SER A:148 , MSE A:149 , GLU A:150 , GLN A:165 , TRP A:166 , THR A:167 , TYR A:170 , HOH A:1003 , HOH A:1009 , HOH A:1011 , HOH A:1028BINDING SITE FOR RESIDUE SAI A 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XTP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XTP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XTP)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XTP)

(-) Exons   (0, 0)

(no "Exon" information available for 1XTP)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:246
 aligned with Q4Q7M2_LEIMA | Q4Q7M2 from UniProtKB/TrEMBL  Length:250

    Alignment length:250
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250
         Q4Q7M2_LEIMA     1 MPSKEASSRNLPISGRDTNGKTYRSTDEMWKAELTGDLYDPEKGWYGKALEYWRTVPATVSGVLGGMDHVHDVDIEGSRNFIASLPGHGTSRALDCGAGIGRITKNLLTKLYATTDLLEPVKHMLEEAKRELAGMPVGKFILASMETATLPPNTYDLIVIQWTAIYLTDADFVKFFKHCQQALTPNGYIFFKENCSTGDRFLVDKEDSSLTRSDIHYKRLFNESGVRVVKEAFQEEWPTDLFPLKMYALK 250
               SCOP domains d1xtpa  _ A: Hypothetical protein Lmaj004091aaa (LmjF30.0810)                                                                                                                                                                                              SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------  --------------------------------Methyltransf_PK-1xtpA01 A:45-254                                                                                                                                                                                   Pfam domains
         Sec.struct. author ......--......eee....ee.hhhhhhhhhh.........hhhhhhhhhhhh...hhhhhh..hhhhhhhhhhhhhhhhhh.......eeeee....hhhhhhhhhhhh.eeeeee.hhhhhhhhhhhh....eeeeee.hhhhh......eeeeeee.hhhhhhhhhhhhhhhhhhhheeeeeeeeeeee..--..eeee....eee.hhhhhhhhhhhhh.eeeeeee..........eeeeeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xtp A   1 GPGSmP--RNLPISGRDTNGKTYRSTDEmWKAELTGDLYDPEKGWYGKALEYWRTVPATVSGVLGGmDHVHDVDIEGSRNFIASLPGHGTSRALDCGAGIGRITKNLLTKLYATTDLLEPVKHmLEEAKRELAGmPVGKFILASmETATLPPNTYDLIVIQWTAIYLTDADFVKFFKHCQQALTPNGYIFFKENCS--DRFLVDKEDSSLTRSDIHYKRLFNESGVRVVKEAFQEEWPTDLFPLKmYALK 254
                                ||  14        24        34        44        54        64      | 74        84        94       104       114       124   |   134    |  144    |  154       164       174       184       194     | 204       214       224       234       244     | 254
                                || 13                  33-MSE                                71-MSE                                                  128-MSE    139-MSE   149-MSE                                            200  |                                            250-MSE
                                5-MSE                                                                                                                                                                                           203                                                   
                                 6
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1XTP)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: NADP_Rossmann (1239)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q4Q7M2_LEIMA | Q4Q7M2)
molecular function
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
biological process
    GO:0006480    N-terminal protein amino acid methylation    The methylation of the N-terminal amino acid of a protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SAI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xtp)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xtp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q4Q7M2_LEIMA | Q4Q7M2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q4Q7M2_LEIMA | Q4Q7M2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1XTP)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XTP)