Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF VCBP3, DOMAIN 1, FROM BRANCHIOSTOMA FLORIDAE
 
Authors :  J. A. Hernandez Prada, R. N. Haire, J. P. Cannon, M. Allaire, J. Jakoncic, V. Stojanoff, G. W. Litman, D. A. Ostrov
Date :  21 Oct 04  (Deposition) - 04 Oct 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.15
Chains :  Asym./Biol. Unit :  A
Keywords :  Innate Immunity, Vcbp, Primordial Antigen Receptor, Florida Lancelet, Amphioxus, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. N. Haire, M. Allaire, J. Jakoncic, V. Stojanoff, J. P. Cannon, G. W. Litman, D. A. Ostrov
Ancient Evolutionary Origin Of Diversified Variable Regions Demonstrated By Crystal Structures Of An Immune-Type Receptor In Amphioxus.
Nat. Immunol. V. 7 875 2006
PubMed-ID: 16799561  |  Reference-DOI: 10.1038/NI1359
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - VARIABLE REGION-CONTAINING CHITIN-BINDING PROTEIN 3
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: VCBP3
    Organism Common: FLORIDA LANCELET
    Organism Scientific: BRANCHIOSTOMA FLORIDAE
    Organism Taxid: 7739

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1SO41Ligand/IonSULFATE ION

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:2 , SER A:3 , GLN A:113 , ARG A:117 , THR A:118 , HOH A:1037 , HOH A:1103 , HOH A:1124BINDING SITE FOR RESIDUE SO4 A 201

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:26 -A:109

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XT5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XT5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XT5)

(-) Exons   (0, 0)

(no "Exon" information available for 1XT5)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:135
 aligned with Q8I9N0_BRAFL | Q8I9N0 from UniProtKB/TrEMBL  Length:334

    Alignment length:135
                                    25        35        45        55        65        75        85        95       105       115       125       135       145     
         Q8I9N0_BRAFL    16 GQSIMTVRTTHTEVEVHAGGTVELPCSYQLANDTQPPVISWLKGASPDRSTKVFKGNYNWQGEGLGFVESDSYKESFGDFLGRASVANLAAPTLRLTHVHPQDGGRYWCQVAQWSIRTEFGLDAKSVVLKVTGHT 150
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----V-set-1xt5A01 A:5-131                                                                                                          ---- Pfam domains
         Sec.struct. author ...eeeee....eeeee....eee..eeeee......eeeeeee.....eeeeeeeee.............eeeee.hhhh..eee.......eee...hhhhheeeeeeee.....hhh.eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xt5 A   1 GQSIMTVRTTHTEVEVHAGGTVELPCSYQLANDTQPPVISWLKGASPDRSTKVFKGNYNWQGEGLGFVESDSYKESFGDFLGRASVANLAAPTLRLTHVHPQDGGRYWCQVAQWSIRTEFGLDAKSVVLKVTGHT 135
                                    10        20        30        40        50        60        70        80        90       100       110       120       130
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1XT5)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1XT5)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: Ig (577)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q8I9N0_BRAFL | Q8I9N0)
molecular function
    GO:0008061    chitin binding    Interacting selectively and non-covalently with chitin, a linear polysaccharide consisting of beta-(1->4)-linked N-acetyl-D-glucosamine residues.
biological process
    GO:0006030    chitin metabolic process    The chemical reactions and pathways involving chitin, a linear polysaccharide consisting of beta-(1->4)-linked N-acetyl-D-glucosamine residues.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xt5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xt5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8I9N0_BRAFL | Q8I9N0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8I9N0_BRAFL | Q8I9N0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8I9N0_BRAFL | Q8I9N0: 2fbo

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XT5)