Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF UREIDOGLYCOLATE HYDROLASE FROM E.COLI. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET ET81.
 
Authors :  A. P. Kuzin, S. M. Vorobiev, M. Abashidze, T. B. Acton, L. -C. Ma, R. Xiao, G. T. Montelione, J. F. Hunt, L. Tong, Northeast Structural Genomics Consortium (Nesg)
Date :  19 Oct 04  (Deposition) - 02 Nov 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Northeast Structural Genomics Consortium, Nesg, Structural Genomics, Protein Structure Initiative, Psi, Et81, X-Ray, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. P. Kuzin, S. M. Vorobiev, M. Abashidze, T. B. Acton, L. -C. Ma, R. Xiao, G. T. Montelione, J. F. Hunt, L. Tong
Crystal Structure Of Ureidoglycolate Hydrolase From E. Coli. Northeast Structural Genomics Consortium Target Et81.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - UREIDOGLYCOLATE HYDROLASE
    Chains: A, B
    EC Number: 3.5.3.19
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET15B
    Expression System Strain: BL21(DE3)+MAGIC
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: ALLA
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1XSQ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XSQ)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Leu A:64 -Pro A:65
2Leu B:64 -Pro B:65

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XSQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XSQ)

(-) Exons   (0, 0)

(no "Exon" information available for 1XSQ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:154
 aligned with ALLA_ECOLI | P77731 from UniProtKB/Swiss-Prot  Length:160

    Alignment length:160
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160
           ALLA_ECOLI     1 MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVEILEQDCTLISINRAQPANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA 160
               SCOP domains d1xsqa_ A: Ureidoglycolate hyd    rolase AllA                                                                                                                    SCOP domains
               CATH domains -1xsqA00 A:2-160 Ureidoglycola    te hydrolase                                                                                                                   CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.hhhhhh..eeee..........----.eeeeeeeee.......eeeeeeee.......eeeeeee.....eeeee......eeeeee.....eeeeeeeee.....eeee....ee.........eeeeeee..--...eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xsq A   1 mKLQVLPLSQEAFSAYGDVIETQQRDFFHI----VERYHDLALVEILEQDCTLISINRAQPANLPLTIHELERHPLGTQAFIPmKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRG--DNCDVESIPEQELCFA 160
                            |       10        20        30    |   40        50        60        70        80   |    90       100       110       120       130       140 |  |  150       160
                            |                           30   35                                               84-MSE                                                   142  |               
                            1-MSE                                                                                                                                         145               


Chain B from PDB  Type:PROTEIN  Length:155
 aligned with ALLA_ECOLI | P77731 from UniProtKB/Swiss-Prot  Length:160

    Alignment length:161
                                                                                                                                                                                         160 
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160 
           ALLA_ECOLI     1 MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVEILEQDCTLISINRAQPANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA-   -
               SCOP domains d1xsqb_ B: Ureidoglycolate hyd    rolase AllA                                                                                                                     SCOP domains
               CATH domains -1xsqB00 B:2-161 Ureidoglycola    te hydrolase                                                                                                                    CATH domains
           Pfam domains (1) Ureidogly_hydro-1xsqB01 B:1-15    8                                                                                                                           --- Pfam domains (1)
           Pfam domains (2) Ureidogly_hydro-1xsqB02 B:1-15    8                                                                                                                           --- Pfam domains (2)
         Sec.struct. author .eeeeee.hhhhhh..eeee..........----.eeeeeeeee.......eeeeeeee.ee....eeeeeee.....eeeee......eeeee......hhhhheeee.....eeee....ee....ee...eeeeeee..--...eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xsq B   1 mKLQVLPLSQEAFSAYGDVIETQQRDFFHI----VERYHDLALVEILEQDCTLISINRAQPANLPLTIHELERHPLGTQAFIPmKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRG--DNCDVESIPEQELCFAL 161
                            |       10        20        30    |   40        50        60        70        80   |    90       100       110       120       130       140 |  |  150       160 
                            1-MSE                       30   35                                               84-MSE                                                   142  |                
                                                                                                                                                                          145
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: Ureidogly_hydro] (3)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (ALLA_ECOLI | P77731)
molecular function
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0004848    ureidoglycolate hydrolase activity    Catalysis of the reaction: (S)-ureidoglycolate + H(2)O + 2 H(+) = CO(2) + glyoxylate + 2 NH(4)(+).
    GO:0050385    ureidoglycolate lyase activity    Catalysis of the reaction: (S)-ureidoglycolate = glyoxylate + urea.
biological process
    GO:0000256    allantoin catabolic process    The chemical reactions and pathways resulting in the breakdown of allantoin, (2,5-dioxo-4-imidazolidinyl)urea.
    GO:0006145    purine nucleobase catabolic process    The chemical reactions and pathways resulting in the breakdown of purine nucleobases, one of the two classes of nitrogen-containing ring compounds found in DNA and RNA, which include adenine and guanine.
    GO:0006144    purine nucleobase metabolic process    The chemical reactions and pathways involving purine nucleobases, one of the two classes of nitrogen-containing ring compounds found in DNA and RNA, which include adenine and guanine.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1xsq)
 
  Cis Peptide Bonds
    Leu A:64 - Pro A:65   [ RasMol ]  
    Leu B:64 - Pro B:65   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xsq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ALLA_ECOLI | P77731
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.5.3.19
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ALLA_ECOLI | P77731
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1XSQ)

(-) Related Entries Specified in the PDB File

et81