|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 11)
Asymmetric Unit (3, 11)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1XQA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1XQA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1XQA) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1XQA) |
Exons (0, 0)| (no "Exon" information available for 1XQA) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:112 aligned with Q81AI8_BACCR | Q81AI8 from UniProtKB/TrEMBL Length:112 Alignment length:113 1 | 9 19 29 39 49 59 69 79 89 99 109 Q81AI8_BACCR - -MGIKHLNLTVADVVAAREFLEKYFGLTCSGTRGNAFAVMRDNDGFILTLMKGKEVQYPKTFHVGFPQESEEQVDKINQRLKEDGFLVEPPKHAHAYTFYVEAPGGFTIEVMC 112 SCOP domains d1xqaa_ A: Hypothetical protein BC3580 SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------- Transcript 1xqa A 0 AmGIKHLNLTVADVVAAREFLEKYFGLTCSGTRGNAFAVmRDNDGFILTLmKGKEVQYPKTFHVGFPQESEEQVDKINQRLKEDGFLVEPPKHA-AYTFYVEAPGGFTIEVmC 112 | 9 19 29 39 49| 59 69 79 89 | | 99 109 | | 39-MSE 50-MSE 93 | 111-MSE 1-MSE 95 Chain B from PDB Type:PROTEIN Length:111 aligned with Q81AI8_BACCR | Q81AI8 from UniProtKB/TrEMBL Length:112 Alignment length:112 10 20 30 40 50 60 70 80 90 100 110 Q81AI8_BACCR 1 MGIKHLNLTVADVVAAREFLEKYFGLTCSGTRGNAFAVMRDNDGFILTLMKGKEVQYPKTFHVGFPQESEEQVDKINQRLKEDGFLVEPPKHAHAYTFYVEAPGGFTIEVMC 112 SCOP domains d1xqab_ B: Hypothetical protein BC3580 SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) -Glyoxalase-1xqaB01 B:2-110 -- Pfam domains (1) Pfam domains (2) -Glyoxalase-1xqaB02 B:2-110 -- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------- Transcript 1xqa B 1 mGIKHLNLTVADVVAAREFLEKYFGLTCSGTRGNAFAVmRDNDGFILTLmKGKEVQYPKTFHVGFPQESEEQVDKINQRLKEDGFLVEPPKHA-AYTFYVEAPGGFTIEVmC 112 | 10 20 30 40 50 60 70 80 90 | | 100 110| | 39-MSE 50-MSE 93 | 111-MSE 1-MSE 95
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1XQA) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1XQA)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|