|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 12)| Asymmetric/Biological Unit (2, 12) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1XQ4) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1XQ4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1XQ4) |
PROSITE Motifs (1, 4)
Asymmetric/Biological Unit (1, 4)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1XQ4) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:123 aligned with APAG_BORPE | Q7VU61 from UniProtKB/Swiss-Prot Length:131 Alignment length:123 16 26 36 46 56 66 76 86 96 106 116 126 APAG_BORPE 7 PVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQEVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTMRGTYHCVGENGIPFEVPIAEFLLAMPRT 129 SCOP domains d1xq4a_ A: ApaG SCOP domains CATH domains 1xq4A00 A:7-129 Protein apag CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE APAG PDB: A:7-129 UniProt: 7-131 PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript 1xq4 A 7 PVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQEVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTmRGTYHCVGENGIPFEVPIAEFLLAmPRT 129 16 26 36 46 56 66 76 86 96 | 106 116 126 101-MSE 126-MSE Chain B from PDB Type:PROTEIN Length:121 aligned with APAG_BORPE | Q7VU61 from UniProtKB/Swiss-Prot Length:131 Alignment length:121 16 26 36 46 56 66 76 86 96 106 116 126 APAG_BORPE 7 PVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQEVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTMRGTYHCVGENGIPFEVPIAEFLLAMP 127 SCOP domains d1xq4b_ B: ApaG SCOP domains CATH domains 1xq4B00 B:7-127 Protein apag CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE APAG PDB: B:7-127 UniProt: 7-131 PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1xq4 B 7 PVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQEVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTmRGTYHCVGENGIPFEVPIAEFLLAmP 127 16 26 36 46 56 66 76 86 96 | 106 116 126 101-MSE 126-MSE Chain C from PDB Type:PROTEIN Length:122 aligned with APAG_BORPE | Q7VU61 from UniProtKB/Swiss-Prot Length:131 Alignment length:122 16 26 36 46 56 66 76 86 96 106 116 126 APAG_BORPE 7 PVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQEVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTMRGTYHCVGENGIPFEVPIAEFLLAMPR 128 SCOP domains d1xq4c_ C: ApaG SCOP domains CATH domains 1xq4C00 C:7-128 Protein apag CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE APAG PDB: C:7-128 UniProt: 7-131 PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript 1xq4 C 7 PVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQEVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTmRGTYHCVGENGIPFEVPIAEFLLAmPR 128 16 26 36 46 56 66 76 86 96 | 106 116 126 101-MSE 126-MSE Chain D from PDB Type:PROTEIN Length:122 aligned with APAG_BORPE | Q7VU61 from UniProtKB/Swiss-Prot Length:131 Alignment length:122 16 26 36 46 56 66 76 86 96 106 116 126 APAG_BORPE 7 PVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQEVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTMRGTYHCVGENGIPFEVPIAEFLLAMPR 128 SCOP domains d1xq4d_ D: ApaG SCOP domains CATH domains 1xq4D00 D:7-128 Protein apag CATH domains Pfam domains (1) ---------------DUF525-1xq4D01 D:22-111 ----------------- Pfam domains (1) Pfam domains (2) ---------------DUF525-1xq4D02 D:22-111 ----------------- Pfam domains (2) Pfam domains (3) ---------------DUF525-1xq4D03 D:22-111 ----------------- Pfam domains (3) Pfam domains (4) ---------------DUF525-1xq4D04 D:22-111 ----------------- Pfam domains (4) SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE APAG PDB: D:7-128 UniProt: 7-131 PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript 1xq4 D 7 PVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQEVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTmRGTYHCVGENGIPFEVPIAEFLLAmPR 128 16 26 36 46 56 66 76 86 96 | 106 116 126 101-MSE 126-MSE
|
||||||||||||||||||||
SCOP Domains (1, 4)| Asymmetric/Biological Unit |
CATH Domains (1, 4)| Asymmetric/Biological Unit |
Pfam Domains (1, 4)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1XQ4)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|