1XO3 - JenaLib

Title :   SOLUTION STRUCTURE OF UBIQUITIN LIKE PROTEIN FROM MUS MUSCULUS

Authors :   S. Singh, M. Tonelli, R. C. Tyler, A. Bahrami, M. S. Lee, J. L. Markley, Center For Eukaryotic Structural Genomics (Cesg)

Date :   05 Oct 04 (Deposition) - 19 Oct 04 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Structural Genomics, Protein Structure Initiative, Center For Eukaryotic Structural Genomics, Psi, Cesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Singh, M. Tonelli, R. C. Tyler, A. Bahrami, M. S. Lee, J. L. Markley
Three-Dimensional Structure Of The Aah26994. 1 Protein From Mus Musculus, A Putative Eukaryotic Urm1.
Protein Sci. V. 14 2095 2005
PubMed-ID: 16046629 | Reference-DOI: 10.1110/PS.051577605
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (5, 5)

NMR Structure (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENSMUST00000091142	2a	ENSMUSE00000909432	chr2:29682862-29682955	94	URM1_MOUSE	1-12	12	1	A:1-12	12
1.3a	ENSMUST00000091142	3a	ENSMUSE00000568262	chr2:29688212-29688282	71	URM1_MOUSE	12-36	25	1	A:12-36	25
1.4	ENSMUST00000091142	4	ENSMUSE00000568261	chr2:29696922-29697003	82	URM1_MOUSE	36-63	28	1	A:36-63	28
1.5c	ENSMUST00000091142	5c	ENSMUSE00000568260	chr2:29698241-29698289	49	URM1_MOUSE	63-79	17	1	A:63-79	17
1.6e	ENSMUST00000091142	6e	ENSMUSE00000809046	chr2:29698623-29700522	1900	URM1_MOUSE	80-101	22	1	A:80-101	22

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:101
 aligned with URM1_MOUSE | Q9D2P4 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:101
                                    10        20        30        40        50        60        70        80        90       100 
           URM1_MOUSE     1 MAAPLCVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG 101
               SCOP domains d1xo3a_ A: C9orf74 homolog                                                                            SCOP domains
               CATH domains 1xo3A00 A:1-101  [code=3.10.20.30, no name defined]                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee..hhhhhhh....eeee........hhhhhhhhhhhhhh..hhhhh.........eeeee..eehhhhh..........eeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a   -----------------------Exon 1.4  PDB: A:36-63      ----------------Exon 1.6e              Transcript 1 (1)
           Transcript 1 (2) -----------Exon 1.3a  PDB: A:12-36  --------------------------Exon 1.5c        ---------------------- Transcript 1 (2)
                 1xo3 A   1 SAAPLCVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG 101
                                    10        20        30        40        50        60        70        80        90       100

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

NMR Structure(hide GO term definitions)

Chain A (URM1_MOUSE | Q9D2P4)

molecular function
	GO:0016783	sulfurtransferase activity	Catalysis of the transfer of sulfur atoms from one compound (donor) to another (acceptor).
biological process
	GO:0032447	protein urmylation	Covalent attachment of the ubiquitin-like protein URM1 to another protein.
	GO:0008033	tRNA processing	The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
	GO:0034227	tRNA thio-modification	The addition a sulfur atom to a nucleotide in a tRNA molecule.
	GO:0002098	tRNA wobble uridine modification	The process in which a uridine in position 34 of a tRNA is post-transcriptionally modified.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1xo3)

	Sites
(no "Sites" information available for 1xo3)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xo3)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1xo3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	URM1_MOUSE \| Q9D2P4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	URM1_MOUSE \| Q9D2P4
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description