Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  X-RAY STRUCTURE OF IAA-AMINOACID HYDROLASE FROM ARABIDOPSIS THALIANA GENE AT5G56660
 
Authors :  G. E. Wesenberg, D. W. Smith, G. N. Phillips Jr. , E. Bitto, C. A. Bingman S. T. M. Allard, Center For Eukaryotic Structural Genomics (Ces
Date :  01 Oct 04  (Deposition) - 12 Oct 04  (Release) - 30 Jan 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Structural Genomics, Protein Structure Initiative, Psi, Cesg, At5G56660, Ill2, Indole-3-Acetic Acid, Auxin, Center For Eukaryotic Structural Genomics, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. Bitto, C. A. Bingman, L. Bittova, N. L. Houston, R. S. Boston, B. G. Fox, G. N. Phillips Jr.
X-Ray Structure Of Ill2, An Auxin-Conjugate Amidohydrolase From Arabidopsis Thaliana.
Proteins V. 74 61 2009
PubMed-ID: 18543330  |  Reference-DOI: 10.1002/PROT.22124

(-) Compounds

Molecule 1 - IAA-AMINO ACID HYDROLASE HOMOLOG 2
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PVP-13
    Expression System Strain: B834(DE3) P(LACI+RARE)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: ILL2
    Organism Common: THALE CRESS
    Organism Scientific: ARABIDOPSIS THALIANA
    Organism Taxid: 3702

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1XMB)

(-) Sites  (0, 0)

(no "Site" information available for 1XMB)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XMB)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Ile A:82 -Gly A:83
2Tyr A:88 -Pro A:89
3Pro A:104 -Pro A:105

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XMB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XMB)

(-) Exons   (0, 0)

(no "Exon" information available for 1XMB)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:375
 aligned with ILL2_ARATH | P54970 from UniProtKB/Swiss-Prot  Length:439

    Alignment length:392
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426  
           ILL2_ARATH    37 KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKGGHAAIPQHTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNGGNAFNVIPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS 428
               SCOP domains d1xmba1 A:37-215,A:335-428 IAA-amino acid hydrolase, catalytic domain                                                                                                              d1xmba2 A:216         -334 IAA-amino acid hydrolase                                                                    d1xmba1 A:37-215,A:335-428 IAA-amino acid hydrolase, catalytic domain                          SCOP domains
               CATH domains 1xmbA01 A:37-215,A:334-428 Zn peptidases                                                                                                                                           1xmbA02 A:216         -333  [code=3.30.70.360, no name defi        ned]                                               1xmbA01 A:37-215,A:334-428 Zn peptidases                                                        CATH domains
           Pfam domains (1) -----------------------------------------------------------------------Peptidase_M20-1xmbA01 A:108-421                                                                                                                                                                                                                                                                                           ------- Pfam domains (1)
           Pfam domains (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M20_dimer-1xmb         A02 A:215-317                                                                   --------------------------------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh..eeeee...eeeeeee.....eeeeeee.........................hhhhhhhhhhhhhhhhhhhhhhh..eeeeeee......hhhhhhhhh.....eeeeeeeeeeeeee...eee..eeee.eeeeeeeeeee.---------.hhhhhhhhhhhhhhhh......hhhh.eeeeeeeee--------..eeeeeeeeee..hhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhh.....eeehhhhhhhhhhhhhhhhh...eee........hhhhhhh...eeeeeeeee................hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xmb A  37 KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGK---------TIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVN--------PDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS 428
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226 |       - |     246       256       266       | -      |286       296       306       316       326       336       346       356       366       376       386       396       406       416       426  
                                                                                                                                                                                                                         228       238                                 274      283
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Clan: Peptidase_MH (119)
(-)
Clan: no clan defined [family: M20_dimer] (13)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (ILL2_ARATH | P54970)
molecular function
    GO:0010179    IAA-Ala conjugate hydrolase activity    Catalysis of the reaction: indole-3-acetyl-alanine + H2O = indole-3-acetate + L-alanine.
    GO:0010178    IAA-amino acid conjugate hydrolase activity    Catalysis of the cleavage of the amide bond between IAA (auxin) and the conjugated amino acid.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
biological process
    GO:0009850    auxin metabolic process    The chemical reactions and pathways involving auxins, a group of plant hormones that regulate aspects of plant growth.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005788    endoplasmic reticulum lumen    The volume enclosed by the membranes of the endoplasmic reticulum.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1xmb)
 
  Sites
(no "Sites" information available for 1xmb)
 
  Cis Peptide Bonds
    Ile A:82 - Gly A:83   [ RasMol ]  
    Pro A:104 - Pro A:105   [ RasMol ]  
    Tyr A:88 - Pro A:89   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xmb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ILL2_ARATH | P54970
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ILL2_ARATH | P54970
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ILL2_ARATH | P54970: 2q43

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XMB)