Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SALICYLIC ACID-BINDING PROTEIN 2 (SABP2) FROM NICOTIANA TABACUM, NESG TARGET AR2241
 
Authors :  F. Forouhar, Y. Chen, Y. Chiang, T. B. Acton, G. T. Montelione, J. F. Hunt Northeast Structural Genomics Consortium (Nesg)
Date :  29 Sep 04  (Deposition) - 30 Nov 04  (Release) - 16 Nov 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Alpha-Beta Protein, Structural Genomics, Protein Structure Initiative, Psi, Northeast Structural Genomics Consortium, Nesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Forouhar, Y. Yang, D. Kumar, Y. Chen, E. Fridman
Structural And Biochemical Studies Identify Tobacco Sabp2 A A Methyl Salicylate Esterase And Implicate It In Plant Innate Immunity
Proc. Natl. Acad. Sci. Usa V. 102 1773 2005
PubMed-ID: 15668381  |  Reference-DOI: 10.1073/PNAS.0409227102

(-) Compounds

Molecule 1 - SALICYLIC ACID-BINDING PROTEIN 2
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidBL21
    Expression System StrainBL21(DE3)+MAGIC
    Expression System Taxid562
    Expression System VectorPET21
    Expression System Vector TypePLASMID
    GeneAAR87711
    Organism CommonCOMMON TOBACCO
    Organism ScientificNICOTIANA TABACUM
    Organism Taxid4097
    SynonymSABP2

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 40)

Asymmetric/Biological Unit (2, 40)
No.NameCountTypeFull Name
1MSE36Mod. Amino AcidSELENOMETHIONINE
2STH4Ligand/Ion2-AMINO-4H-1,3-BENZOXATHIIN-4-OL

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:12 , ALA A:13 , SER A:81 , LEU A:82 , PHE A:107 , TYR A:122 , TRP A:131 , PHE A:151 , LEU A:181 , GLY A:212 , HIS A:238BINDING SITE FOR RESIDUE STH A 297
2AC2SOFTWAREGLY B:12 , ALA B:13 , SER B:81 , LEU B:82 , PHE B:107 , TYR B:122 , TRP B:131 , LEU B:181 , GLY B:212 , HIS B:238BINDING SITE FOR RESIDUE STH B 298
3AC3SOFTWAREGLY C:12 , ALA C:13 , SER C:81 , LEU C:82 , PHE C:107 , TYR C:122 , TRP C:131 , MSE C:149 , PHE C:151 , LEU C:181 , GLY C:212 , HIS C:238BINDING SITE FOR RESIDUE STH C 299
4AC4SOFTWAREGLY D:12 , ALA D:13 , SER D:81 , LEU D:82 , PHE D:107 , TYR D:122 , PHE D:151 , LEU D:181 , GLY D:212 , HIS D:238BINDING SITE FOR RESIDUE STH D 300

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XKL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XKL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XKL)

(-) PROSITE Motifs  (1, 4)

Asymmetric/Biological Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIPASE_SERPS00120 Lipases, serine active site.SABP2_TOBAC75-84
 
 
 
  4A:75-84
B:75-84
C:75-84
D:75-84

(-) Exons   (0, 0)

(no "Exon" information available for 1XKL)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:258
 aligned with SABP2_TOBAC | Q6RYA0 from UniProtKB/Swiss-Prot  Length:260

    Alignment length:258
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252        
          SABP2_TOBAC     3 EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLMELMESLSADEKVILVGHSLGGMNLGLAMEKYPQKIYAAVFLAAFMPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSMFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHMAMLCEPQKLCASLLEIAHKYN 260
               SCOP domains d1xkla_ A: Salicylic acid-binding protein 2 (SABP2)                                                                                                                                                                                                                SCOP domains
               CATH domains 1xklA00 A:3-260  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee.....hhhhhhhhhhhhhhh..eeee...........hhhhh.hhhhhhhhhhhhhhh......eeeeee.hhhhhhhhhhhhh...eeeeeee...........hhhhhhhhhh.........eeee........eeee.hhhhhhhhh....hhhhhhhhhhhh.....hhhhhhhh......hhhhh.eeeeee......hhhhhhhhhhhhh..eeeee.....hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------LIPASE_SER-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1xkl A   3 EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLmELmESLSADEKVILVGHSLGGmNLGLAmEKYPQKIYAAVFLAAFmPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSmFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFmEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHmAmLCEPQKLCASLLEIAHKYN 260
                                    12        22        32        42        52        62|  |    72        82  |     92       102     | 112       122       132       142      |152       162       172       182|      192       202       212       222       232      |242       252        
                                                                                       63-MSE                85-MSE |              108-MSE                                  149-MSE                           183-MSE                                                 239-MSE                 
                                                                                          66-MSE                   91-MSE                                                                                                                                               241-MSE               

Chain B from PDB  Type:PROTEIN  Length:256
 aligned with SABP2_TOBAC | Q6RYA0 from UniProtKB/Swiss-Prot  Length:260

    Alignment length:256
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252      
          SABP2_TOBAC     3 EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLMELMESLSADEKVILVGHSLGGMNLGLAMEKYPQKIYAAVFLAAFMPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSMFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHMAMLCEPQKLCASLLEIAHK 258
               SCOP domains d1xklb_ B: Salicylic acid-binding protein 2 (SABP2)                                                                                                                                                                                                              SCOP domains
               CATH domains 1xklB00 B:3-258  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                            CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....hhhhhhhhhhhhhhh..eeee...........hhhhh.hhhhhhhhhhhhhhh......eeeeee.hhhhhhhhhhhhh...eeeeeee...........hhhhhhhhhhhhhhhhh..eeee........eeee.hhhhhhhhh....hhhhhhhhhhhh.....hhhhhhhh......hhhhh.eeeeee......hhhhhhhhhhhhh..eeeee.....hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------LIPASE_SER------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xkl B   3 EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLmELmESLSADEKVILVGHSLGGmNLGLAmEKYPQKIYAAVFLAAFmPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSmFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFmEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHmAmLCEPQKLCASLLEIAHK 258
                                    12        22        32        42        52        62|  |    72        82  |     92       102     | 112       122       132       142      |152       162       172       182|      192       202       212       222       232      |242       252      
                                                                                       63-MSE                85-MSE |              108-MSE                                  149-MSE                           183-MSE                                                 239-MSE               
                                                                                          66-MSE                   91-MSE                                                                                                                                               241-MSE             

Chain C from PDB  Type:PROTEIN  Length:257
 aligned with SABP2_TOBAC | Q6RYA0 from UniProtKB/Swiss-Prot  Length:260

    Alignment length:257
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       
          SABP2_TOBAC     3 EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLMELMESLSADEKVILVGHSLGGMNLGLAMEKYPQKIYAAVFLAAFMPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSMFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHMAMLCEPQKLCASLLEIAHKY 259
               SCOP domains d1xklc_ C: Salicylic acid-binding protein 2 (SABP2)                                                                                                                                                                                                               SCOP domains
               CATH domains 1xklC00 C:3-259  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....hhhhhhhhhhhhhhh..eeeee..........hhhhh.hhhhhhhhhhhhhhhh.....eeeeee.hhhhhhhhhhhhh...eeeeeee...........hhhhhhhhhhhhhhhhh..eeee........eeee.hhhhhhhhh....hhhhhhhhhhhh.....hhhhhhh.......hhhhh.eeeeee......hhhhhhhhhhhhh..eeeee.....hhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------LIPASE_SER------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xkl C   3 EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLmELmESLSADEKVILVGHSLGGmNLGLAmEKYPQKIYAAVFLAAFmPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSmFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFmEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHmAmLCEPQKLCASLLEIAHKY 259
                                    12        22        32        42        52        62|  |    72        82  |     92       102     | 112       122       132       142      |152       162       172       182|      192       202       212       222       232      |242       252       
                                                                                       63-MSE                85-MSE |              108-MSE                                  149-MSE                           183-MSE                                                 239-MSE                
                                                                                          66-MSE                   91-MSE                                                                                                                                               241-MSE              

Chain D from PDB  Type:PROTEIN  Length:257
 aligned with SABP2_TOBAC | Q6RYA0 from UniProtKB/Swiss-Prot  Length:260

    Alignment length:258
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252        
          SABP2_TOBAC     3 EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLMELMESLSADEKVILVGHSLGGMNLGLAMEKYPQKIYAAVFLAAFMPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSMFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHMAMLCEPQKLCASLLEIAHKYN 260
               SCOP domains d1xkld_ D: Salicylic acid-binding protein 2 (SABP2)                                                                                                                                                                                                                SCOP domains
               CATH domains 1xklD00 D:3-260  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee.....hhhhhh.hhhhhhhh..eeee...........hhhhh.hhhhhhhhhhhhhhhh.....eeeeee.hhhhhhhhhhhhh...eeeeeee...........hhhhhhhhhh.hhhhhh..eeee........eeee.hhhhhhhhh....hhhhhhhhhhhh.....hhhhhh..-.....hhhhh.eeeeee......hhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------LIPASE_SER-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1xkl D   3 EGKHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASGTDLRKIEELRTLYDYTLPLmELmESLSADEKVILVGHSLGGmNLGLAmEKYPQKIYAAVFLAAFmPDSVHNSSFVLEQYNERTPAENWLDTQFLPYGSPEEPLTSmFFGPKFLAHKLYQLCSPEDLALASSLVRPSSLFmEDLSKA-YFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIKGADHmAmLCEPQKLCASLLEIAHKYN 260
                                    12        22        32        42        52        62|  |    72        82  |     92       102     | 112       122       132       142      |152       162       172       182|     |192       202       212       222       232      |242       252        
                                                                                       63-MSE                85-MSE |              108-MSE                                  149-MSE                           183-MSE89 |                                             239-MSE                 
                                                                                          66-MSE                   91-MSE                                                                                             191                                               241-MSE               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1XKL)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (SABP2_TOBAC | Q6RYA0)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016298    lipase activity    Catalysis of the hydrolysis of a lipid or phospholipid.
    GO:0080031    methyl salicylate esterase activity    Catalysis of the reaction: methyl salicylate + H2O = salicylic acid + methanol + H+.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0009862    systemic acquired resistance, salicylic acid mediated signaling pathway    The series of molecular signals mediated by salicylic acid involved in systemic acquired resistance.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    STH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xkl)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xkl
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SABP2_TOBAC | Q6RYA0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SABP2_TOBAC | Q6RYA0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SABP2_TOBAC | Q6RYA01y7h 1y7i

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XKL)