|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1XJH) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1XJH) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1XJH) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1XJH) |
Exons (0, 0)| (no "Exon" information available for 1XJH) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:62 aligned with HSLO_ECOLI | P0A6Y5 from UniProtKB/Swiss-Prot Length:292 Alignment length:62 233 243 253 263 273 283 HSLO_ECOLI 224 QDVEFKCTCSRERCADALKTLPDEEVDSILAEDGEIDMHCDYCGNHYLFNAMDIAEIRNNAS 285 SCOP domains d1xjha_ A: HSP33, C-terminal domain SCOP domains CATH domains 1xjhA00 A:1-62 HSP33-like CATH domains Pfam domains -HSP33-1xjhA01 A:2-51 ----------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 1xjh A 1 MDVEFKCTCSRERCADALKTLPDEEVDSILAEDGEIDMHCDYCGNHYLFNAMDIAEIRNNAS 62 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (HSLO_ECOLI | P0A6Y5)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|