1XIU - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE AGONIST-BOUND LIGAND-BINDING DOMAIN OF BIOMPHALARIA GLABRATA RXR

Authors :   A. De Groot, E. De Rosny, C. Juillan-Binard, J. -L. Ferrer, V. Laudet, Peroula, J. -C. Fontecilla-Camps, F. Borel

Date :   22 Sep 04 (Deposition) - 13 Sep 05 (Release) - 16 Nov 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B,E,F
Biol. Unit 1: A,B,E,F  (2x)

Keywords :   Nuclear Receptor, Protein-Ligand Complex, Retinoid Receptor, Transcription-Transferase Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. De Groot, E. De Rosny, C. Juillan-Binard, J. -L. Ferrer, V. Laudet R. J. Pierce, E. Pebay-Peyroula, J. -C. Fontecilla-Camps, F. Borel
Crystal Structure Of A Novel Tetrameric Complex Of Agonist-Bound Ligand-Binding Domain Of Biomphalaria Glabrat Retinoid X Receptor.
J. Mol. Biol. V. 354 841 2005
PubMed-ID: 16274693 | Reference-DOI: 10.1016/J.JMB.2005.09.090

Molecule 1 - RXR-LIKE PROTEIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A
	Expression System Strain	:	BL21(DE3) PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	LIGAND-BINDING DOMAIN (LBD)
	Gene	:	RXR
	Organism Scientific	:	BIOMPHALARIA GLABRATA
	Organism Taxid	:	6526
	Synonym	:	RETINOID X RECEPTOR LIGAND-BINDING DOMAIN, 9-CIS RETINOIC ACID

Molecule 2 - NUCLEAR RECEPTOR COACTIVATOR 1
	Chains	:	E, F
	EC Number	:	2.3.1.48
	Engineered	:	YES
	Other Details	:	THE PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THE PEPTIDE IS DERIVED FROM HUMAN SRC-1 COACTIVATOR.
	Synonym	:	NCOA-1, STEROID RECEPTOR COACTIVATOR-1, SRC-1, RIP160, HIN-2 PROTEIN
	Synthetic	:	YES

		1	2	3	4
Asymmetric Unit	:	A	B	E	F
Biological Unit 1 (2x)	:	A	B	E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	9CR	2	Ligand/Ion	(9CIS)-RETINOIC ACID

Biological Unit 1 (1, 4)

No.	Name	Count	Type	Full Name
1	9CR	4	Ligand/Ion	(9CIS)-RETINOIC ACID

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ALA A:245 , ALA A:246 , GLN A:249 , PHE A:287 , ARG A:290 , LEU A:300 , ALA A:301 , VAL A:316 , CYS A:406 , HIS A:409	BINDING SITE FOR RESIDUE 9CR A 201
2	AC2	SOFTWARE	ILE B:242 , ALA B:246 , GLN B:249 , PHE B:287 , ARG B:290 , LEU B:300 , ALA B:301 , CYS B:406 , HIS B:409	BINDING SITE FOR RESIDUE 9CR B 202

(no "SS Bond" information available for 1XIU)

(no "Cis Peptide Bond" information available for 1XIU)

(no "SAP(SNP)/Variant" information available for 1XIU)

(no "PROSITE Motif" information available for 1XIU)

Asymmetric Unit (1, 2)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.5c	ENST00000348332	5c	ENSE00001412482	chr2:24807346-24807429	84	NCOA1_HUMAN	-	0	0	-	-
1.6b	ENST00000348332	6b	ENSE00001353786	chr2:24866835-24866991	157	NCOA1_HUMAN	-	0	0	-	-
1.7a	ENST00000348332	7a	ENSE00002170964	chr2:24881530-24881635	106	NCOA1_HUMAN	1-30	30	0	-	-
1.8	ENST00000348332	8	ENSE00001070983	chr2:24888618-24888784	167	NCOA1_HUMAN	30-86	57	0	-	-
1.9	ENST00000348332	9	ENSE00001781523	chr2:24896235-24896332	98	NCOA1_HUMAN	86-118	33	0	-	-
1.10	ENST00000348332	10	ENSE00001796214	chr2:24905820-24905997	178	NCOA1_HUMAN	119-178	60	0	-	-
1.11	ENST00000348332	11	ENSE00001070993	chr2:24914350-24914529	180	NCOA1_HUMAN	178-238	61	0	-	-
1.12	ENST00000348332	12	ENSE00001070995	chr2:24916121-24916216	96	NCOA1_HUMAN	238-270	33	0	-	-
1.13	ENST00000348332	13	ENSE00001070992	chr2:24920527-24920667	141	NCOA1_HUMAN	270-317	48	0	-	-
1.14	ENST00000348332	14	ENSE00001071000	chr2:24927955-24928102	148	NCOA1_HUMAN	317-366	50	0	-	-
1.15a	ENST00000348332	15a	ENSE00001070985	chr2:24929437-24930757	1321	NCOA1_HUMAN	366-806	441	2	E:687-698 F:688-697	12 10
1.16a	ENST00000348332	16a	ENSE00000808887	chr2:24933800-24933980	181	NCOA1_HUMAN	807-867	61	0	-	-
1.17	ENST00000348332	17	ENSE00000808888	chr2:24949458-24949575	118	NCOA1_HUMAN	867-906	40	0	-	-
1.18	ENST00000348332	18	ENSE00000808889	chr2:24951177-24951345	169	NCOA1_HUMAN	906-962	57	0	-	-
1.19	ENST00000348332	19	ENSE00000808890	chr2:24952370-24952684	315	NCOA1_HUMAN	963-1067	105	0	-	-
1.20	ENST00000348332	20	ENSE00000726392	chr2:24962301-24962402	102	NCOA1_HUMAN	1068-1101	34	0	-	-
1.21	ENST00000348332	21	ENSE00000726395	chr2:24964653-24965055	403	NCOA1_HUMAN	1102-1236	135	0	-	-
1.22	ENST00000348332	22	ENSE00000808891	chr2:24974851-24975025	175	NCOA1_HUMAN	1236-1294	59	0	-	-
1.23	ENST00000348332	23	ENSE00000726401	chr2:24980842-24981025	184	NCOA1_HUMAN	1294-1355	62	0	-	-
1.24	ENST00000348332	24	ENSE00000726404	chr2:24985556-24985645	90	NCOA1_HUMAN	1356-1385	30	0	-	-
1.26b	ENST00000348332	26b	ENSE00001797482	chr2:24991090-24993571	2482	NCOA1_HUMAN	1386-1441	56	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:221
 aligned with RXR_BIOGL | Q8T5C6 from UniProtKB/Swiss-Prot  Length:436

    Alignment length:221
                                   219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429 
            RXR_BIOGL   210 NDMPVEQILEAELAVDPKIDTYIDAQKDPVTNICQAADKQLFTLVEWAKRIPHFTELPLEDQVILLRAGWNELLIAGFSHRSIMAKDGILLATGLHVHRSSAHQAGVGTIFDRVLTELVAKMRDMKMDKTELGCLRAVVLFNPDAKGLTAVQEVEQLREKVYASLEEYTKSRYPEEPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDQPIDTFLMEMLE 430
               SCOP domains d1xiua_ A: automated matches                                                                                                                                                                                                  SCOP domains
               CATH domains 1xiuA00 A:210-430 Retinoid X Receptor                                                                                                                                                                                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh......eee..hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee....eeeehhhhhhh.hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xiu A 210 NDMPVEQILEAELAVDPKIDTYIDAQKDPVTNICQAADKQLFTLVEWAKRIPHFTELPLEDQVILLRAGWNELLIAGFSHRSIMAKDGILLATGLHVHRSSAHQAGVGTIFDRVLTELVAKMRDMKMDKTELGCLRAVVLFNPDAKGLTAVQEVEQLREKVYASLEEYTKSRYPEEPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDQPIDTFLMEMLE 430
                                   219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429

Chain B from PDB  Type:PROTEIN  Length:224
 aligned with RXR_BIOGL | Q8T5C6 from UniProtKB/Swiss-Prot  Length:436

    Alignment length:224
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428    
            RXR_BIOGL   209 NNDMPVEQILEAELAVDPKIDTYIDAQKDPVTNICQAADKQLFTLVEWAKRIPHFTELPLEDQVILLRAGWNELLIAGFSHRSIMAKDGILLATGLHVHRSSAHQAGVGTIFDRVLTELVAKMRDMKMDKTELGCLRAVVLFNPDAKGLTAVQEVEQLREKVYASLEEYTKSRYPEEPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDQPIDTFLMEMLENP 432
               SCOP domains d1xiub_ B: automated matches                                                                                                                                                                                                     SCOP domains
               CATH domains 1xiuB00 B:209-432 Retinoid X Receptor                                                                                                                                                                                            CATH domains
           Pfam domains (1) ---------------Hormone_recep-1xiuB01 B:224-416                                                                                                                                                                  ---------------- Pfam domains (1)
           Pfam domains (2) ---------------Hormone_recep-1xiuB02 B:224-416                                                                                                                                                                  ---------------- Pfam domains (2)
         Sec.struct. author ....hhhhhhhhhhhhh......ee...hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee....eeeehhhhhhh.hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xiu B 209 NNDMPVEQILEAELAVDPKIDTYIDAQKDPVTNICQAADKQLFTLVEWAKRIPHFTELPLEDQVILLRAGWNELLIAGFSHRSIMAKDGILLATGLHVHRSSAHQAGVGTIFDRVLTELVAKMRDMKMDKTELGCLRAVVLFNPDAKGLTAVQEVEQLREKVYASLEEYTKSRYPEEPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDQPIDTFLMEMLENP 432
                                   218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428

Chain E from PDB  Type:PROTEIN  Length:12
 aligned with NCOA1_HUMAN | Q15788 from UniProtKB/Swiss-Prot  Length:1441

    Alignment length:12
                                   696  
          NCOA1_HUMAN   687 HKILHRLLQEGS 698
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ------------ PROSITE
               Transcript 1 Exon 1.15a   Transcript 1
                 1xiu E 687 HKILHRLLQEGS 698
                                   696

Chain F from PDB  Type:PROTEIN  Length:10
 aligned with NCOA1_HUMAN | Q15788 from UniProtKB/Swiss-Prot  Length:1441

    Alignment length:10
                                   697
          NCOA1_HUMAN   688 KILHRLLQEG 697
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
           Pfam domains (1) SRC-1-1xiu Pfam domains (1)
           Pfam domains (2) SRC-1-1xiu Pfam domains (2)
         Sec.struct. author .hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
               Transcript 1 Exon 1.15a Transcript 1
                 1xiu F 688 KILHRLLQEG 697
                                   697

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Nuclear receptor ligand-binding domain (609)

Superfamily: Nuclear receptor ligand-binding domain (609)

Family: Nuclear receptor ligand-binding domain (598)

Protein domain: automated matches (140)

Biomphalaria glabrata [TaxId: 6526] (1)

1a	d1xiua_	A:
1b	d1xiub_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Retinoid X Receptor (409)

Homologous Superfamily: Retinoid X Receptor (409)

Biomphalaria glabrata. Organism_taxid: 6526. (1)

1a	1xiuB00	B:209-432
1b	1xiuA00	A:210-430

Asymmetric Unit(hide GO term definitions)

Chain A,B (RXR_BIOGL | Q8T5C6)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016918	retinal binding	Interacting selectively and non-covalently with retinal, one of the forms of vitamin A. Retinal plays an important role in the visual process in most vertebrates, combining with opsins to form visual pigments in the retina.
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0003707	steroid hormone receptor activity	Combining with a steroid hormone and transmitting the signal within the cell to initiate a change in cell activity or function.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0043401	steroid hormone mediated signaling pathway	A series of molecular signals mediated by a steroid hormone binding to a receptor.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain E,F (NCOA1_HUMAN | Q15788)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0001012	RNA polymerase II regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that controls the transcription of a region of DNA by RNA polymerase II. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0001105	RNA polymerase II transcription coactivator activity	Interacting selectively and non-covalently with an RNA polymerase II (RNAP II) regulatory transcription factor and also with the RNAP II basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind DNA, but rather mediate protein-protein interactions between activating transcription factors and the basal RNAP II transcription machinery.
	GO:0050681	androgen receptor binding	Interacting selectively and non-covalently with an androgen receptor.
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0030331	estrogen receptor binding	Interacting selectively and non-covalently with an estrogen receptor.
	GO:0004402	histone acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + histone = CoA + acetyl-histone.
	GO:0016922	ligand-dependent nuclear receptor binding	Interacting selectively and non-covalently, in a ligand dependent manner, with a nuclear receptor protein.
	GO:0030374	ligand-dependent nuclear receptor transcription coactivator activity	The function of a transcription cofactor that activates transcription in conjuction with a ligand-dependent nuclear receptor from a RNA polymerase II promoter; does not bind DNA itself.
	GO:0035257	nuclear hormone receptor binding	Interacting selectively and non-covalently with a nuclear hormone receptor, a ligand-dependent receptor found in the nucleus of the cell.
	GO:0033142	progesterone receptor binding	Interacting selectively and non-covalently with a progesterone receptor.
	GO:0047485	protein N-terminus binding	Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046983	protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
	GO:0042974	retinoic acid receptor binding	Interacting selectively and non-covalently with the retinoic acid receptor, a ligand-regulated transcription factor belonging to the nuclear receptor superfamily.
	GO:0046965	retinoid X receptor binding	Interacting selectively and non-covalently with a retinoid X receptor.
	GO:0003713	transcription coactivator activity	Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016746	transferase activity, transferring acyl groups	Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
	GO:0030521	androgen receptor signaling pathway	Any series of molecular signals generated as a consequence of an androgen binding to its receptor.
	GO:0015721	bile acid and bile salt transport	The directed movement of bile acid and bile salts into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0044255	cellular lipid metabolic process	The chemical reactions and pathways involving lipids, as carried out by individual cells.
	GO:1904017	cellular response to Thyroglobulin triiodothyronine	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a Thyroglobulin triiodothyronine stimulus.
	GO:0032870	cellular response to hormone stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
	GO:0021549	cerebellum development	The process whose specific outcome is the progression of the cerebellum over time, from its formation to the mature structure. The cerebellum is the portion of the brain in the back of the head between the cerebrum and the pons. In mice, the cerebellum controls balance for walking and standing, modulates the force and range of movement and is involved in the learning of motor skills.
	GO:0021987	cerebral cortex development	The progression of the cerebral cortex over time from its initial formation until its mature state. The cerebral cortex is the outer layered region of the telencephalon.
	GO:0044849	estrous cycle	A type of ovulation cycle, which occurs in most mammalian therian females, where the endometrium is resorbed if pregnancy does not occur.
	GO:0021766	hippocampus development	The progression of the hippocampus over time from its initial formation until its mature state.
	GO:0043967	histone H4 acetylation	The modification of histone H4 by the addition of an acetyl group.
	GO:0021854	hypothalamus development	The progression of the hypothalamus region of the forebrain, from its initial formation to its mature state.
	GO:0030522	intracellular receptor signaling pathway	Any series of molecular signals initiated by a ligand binding to an receptor located within a cell.
	GO:0060713	labyrinthine layer morphogenesis	The process in which the labyrinthine layer of the placenta is generated and organized.
	GO:0007595	lactation	The regulated release of milk from the mammary glands and the period of time that a mother lactates to feed her young.
	GO:0008584	male gonad development	The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
	GO:0060179	male mating behavior	The specific behavior of a male organism that is associated with reproduction.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0045925	positive regulation of female receptivity	Any process that activates or increases the receptiveness of a female to male advances.
	GO:0045666	positive regulation of neuron differentiation	Any process that activates or increases the frequency, rate or extent of neuron differentiation.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0000435	positive regulation of transcription from RNA polymerase II promoter by galactose	Any process involving galactose that activates or increases the rate of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:2001141	regulation of RNA biosynthetic process	Any process that modulates the frequency, rate or extent of RNA biosynthetic process.
	GO:2001038	regulation of cellular response to drug	Any process that modulates the frequency, rate or extent of cellular response to drug.
	GO:0002155	regulation of thyroid hormone mediated signaling pathway	Any process that modulates the frequency, rate or extent of a thyroid hormone mediated signaling pathway.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0032355	response to estradiol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
	GO:0009725	response to hormone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
	GO:0032570	response to progesterone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a progesterone stimulus.
	GO:0032526	response to retinoic acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0000790	nuclear chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		9CR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xiu)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1xiu
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NCOA1_HUMAN \| Q15788
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	RXR_BIOGL \| Q8T5C6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.3.1.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NCOA1_HUMAN \| Q15788
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	RXR_BIOGL \| Q8T5C6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1fby	HUMAN HOMOLOGUE WITH RETINOIC ACID
1g1u	HUMAN HOMOLOGUE WITHOUT RETINOIC ACID (TETRAMER)
1lbd	HUMAN HOMOLOGUE WITHOUT RETINOIC ACID (MONOMER)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (1, 2)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (2, 4)

Gene Ontology (66, 70)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File