Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  NADH OXIDASE /NITRITE REDUCTASE FROM PYROCOCCUS FURIOSUS PFU-1140779-001
 
Authors :  P. Horanyi, W. Tempel, M. V. Weinberg, Z. -J. Liu, A. Shah, L. Chen, D. Lee F. J. Sugar, P. S. Brereton, M. Izumi, F. L. Poole Ii, C. Shah, F. E. Jenn W. B. Arendall Iii, J. P. Rose, M. W. W. Adams, J. S. Richardson, D. C. Ri B. -C. Wang, Southeast Collaboratory For Structural Genomics (
Date :  17 Sep 04  (Deposition) - 23 Nov 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.35
Chains :  Asym./Biol. Unit :  A
Keywords :  Nadh Oxidase, Nitrite Reductase, Pyrococcus Furiosus, Southeast Collaboratory For Structural Genomics, Secsg, Hyperthermophile, Protein Structure Initiative, Psi, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. Horanyi, W. Tempel, M. V. Weinberg, Z. -J. Liu, A. Shah, L. Chen, D. Lee, F. J. Sugar, P. S. Brereton, M. Izumi, F. L. Poole Ii, C. Shah, F. E. Jenney Jr. , W. B. Arendall Iii, J. P. Rose, M. W. W. Adams, J. S. Richardson, D. C. Richardson, B. -C. Wang, Southeast Collaboratory For Structural Genomics
Nadh Oxidase /Nitrite Reductase From Pyrococcus Furiosus Pfu-1140779-001
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - NADH OXIDASE /NITRITE REDUCTASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificPYROCOCCUS FURIOSUS
    Organism Taxid186497
    StrainDSM 3638

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:7 , GLY A:9 , PRO A:10 , GLY A:11 , ASP A:29 , LYS A:30 , LYS A:38 , PRO A:39 , GLU A:73 , GLU A:74 , ALA A:75 , ALA A:100 , THR A:101 , GLY A:102 , ALA A:103 , LEU A:119 , ARG A:120 , PHE A:145 , ILE A:146 , GLU A:149 , GLY A:259 , ASP A:260 , GLY A:270 , THR A:271 , ALA A:272 , PHE A:302 , HOH A:361 , HOH A:362 , HOH A:388BINDING SITE FOR RESIDUE FAD A 360

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XHC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XHC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XHC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XHC)

(-) Exons   (0, 0)

(no "Exon" information available for 1XHC)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:346
 aligned with Q8U1K9_PYRFU | Q8U1K9 from UniProtKB/TrEMBL  Length:359

    Alignment length:351
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350 
         Q8U1K9_PYRFU     1 MKVVIVGNGPGGFELAKQLSQTYEVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLDWYRKRGIEIRLAEEAKLIDRGRKVVITEKGEVPYDTLVLATGARAREPQIKGKEYLLTLRTIFDADRIKESIENSGEAIIIGGGFIGLELAGNLAEAGYHVKLIHRGAMFLGLDEELSNMIKDMLEETGVKFFLNSELLEANEEGVLTNSGFIEGKVKICAIGIVPNVDLARRSGIHTGRGILIDDNFRTSAKDVYAIGDCAEYSGIIAGTAKAAMEQARVLADILKGEPRRYNFKFRSTVFKFGKLQIAIIGNTKGEGKWIEDNTKVFYENGKIIGAVVFNDIRKATKLE 351
               SCOP domains d1xhca1 A:1-103,A:226-289 NADH oxidase /nitrite reductase                                              d1xhca2 A:104-225 NADH oxidase /nitrite reductase                                                                         d1xhca1 A:1-103,A:226-289 NADH oxidase /nitrite reductase       d1xhca3 A:290-351 NADH oxidase /nitrite r     eductase         SCOP domains
               CATH domains 1xhcA01 A:1-105,A:224-298  [code=3.50.50.60, no name defined]                                            ----------------------------------------------------------------------------------------------------------------------1xhcA01 A:1-105,A:224-298  [code=3.50.50.60, no name defined]              1xhcA03 A:299-351                                     CATH domains
           Pfam domains (1) ----------------------------------------------------------------------------------------------------------------------------------------Pyr_redox-1xhcA01 A:137-211                                                -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -Pyr_redox_2-1xhcA02 A:2-266                                                                                                                                                                                                                                              ------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author .eeeee..hhhhhhhhhhhh...eeeee...........hhhhhhh...hhhhhh..hhhhhhhhheeee....eeeee....eeee...eee..eeee...eee......hhh.ee...hhhhhhhhhhhhhhhheeeeee.hhhhhhhhhhhhhh..eeeee.........hhhhhhhhhhhhhhh.eeee....eeee...eeee..eeee...eeee..eee.hhhhhhh.......ee...........eee....ee.......hhhhhhhhhhhhhhhhh...........eeeeee..eeeeeee.....eeeee..eeee.-----.eeeee.hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xhc A   1 SKVVIVGNGPGGFELAKQLSQTYEVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLDWYRKRGIEIRLAEEAKLIDRGRKVVITEKGEVPYDTLVLATGARAREPQIKGKEYLLTLRTIFDADRIKESIENSGEAIIIGGGFIGLELAGNLAEAGYHVKLIHRGAMFLGLDEELSNMIKDMLEETGVKFFLNSELLEANEEGVLTNSGFIEGKVKICAIGIVPNVDLARRSGIHTGRGILIDDNFRTSAKDVYAIGDCAEYSGIIAGTAKAAMEQARVLADILKGEPRRYNFKFRSTVFKFGKLQIAIIGNTKGEGKWIEDNTKVFY-----IGAVVFNDIRKATKLE 351
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330     | 340       350 
                                                                                                                                                                                                                                                                                                                                                                   330   336               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q8U1K9_PYRFU | Q8U1K9)
molecular function
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0045454    cell redox homeostasis    Any process that maintains the redox environment of a cell or compartment within a cell.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0005623    cell    The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xhc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xhc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8U1K9_PYRFU | Q8U1K9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8U1K9_PYRFU | Q8U1K9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1XHC)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XHC)