Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE BENZYLPENICILLIN-ACYLATED BLAR1 SENSOR DOMAIN FROM STAPHYLOCOCCUS AUREUS
 
Authors :  M. S. Wilke, T. L. Hills, H. Z. Zhang, H. F. Chambers, N. C. Strynadka
Date :  25 Aug 04  (Deposition) - 21 Sep 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Beta-Lactamase, Benzylpenicillin, Penicillin G, Blar1, Sensor Domain, Antibiotic Resistance, Beta-Lactam, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. S. Wilke, T. L. Hills, H. Z. Zhang, H. F. Chambers, N. C. Strynadka
Crystal Structures Of The Apo And Penicillin-Acylated Forms Of The Blar1 Beta-Lactam Sensor Of Staphylococcus Aureus.
J. Biol. Chem. V. 279 47278 2004
PubMed-ID: 15322076  |  Reference-DOI: 10.1074/JBC.M407054200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - REGULATORY PROTEIN BLAR1
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET41B(+)
    Expression System Strain: ROSETTA (DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: C-TERMINAL DOMAIN (RESIDUES 331-585)
    Gene: BLAR1
    Organism Scientific: STAPHYLOCOCCUS AUREUS
    Organism Taxid: 1280

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 20)

Asymmetric Unit (2, 20)
No.NameCountTypeFull Name
1MSE18Mod. Amino AcidSELENOMETHIONINE
2PG12Mod. Amino AcidPENICILLIN G ACYL-SERINE
Biological Unit 1 (2, 10)
No.NameCountTypeFull Name
1MSE9Mod. Amino AcidSELENOMETHIONINE
2PG11Mod. Amino AcidPENICILLIN G ACYL-SERINE
Biological Unit 2 (2, 10)
No.NameCountTypeFull Name
1MSE9Mod. Amino AcidSELENOMETHIONINE
2PG11Mod. Amino AcidPENICILLIN G ACYL-SERINE

(-) Sites  (0, 0)

(no "Site" information available for 1XA7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1XA7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1XA7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1XA7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1XA7)

(-) Exons   (0, 0)

(no "Exon" information available for 1XA7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:242
 aligned with BLAR_STAAU | P18357 from UniProtKB/Swiss-Prot  Length:585

    Alignment length:248
                                   343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573        
           BLAR_STAAU   334 ITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMKKDKYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGV 581
               SCOP domains d1xa7a_ A:     Regulatory protein BlaR1                                                                                                                                                                                                                  SCOP domains
               CATH domains 1xa7A00 A:    4-251 DD-peptidase/beta-lactamase superfamily                                                                                                                                                                                              CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........----.ee.hhhhhh..eeeeeeee....eeeee..hhhh.ee.hhhhhhhhhhhhhhhh..................hhhhh...hhhhhhhh.hhhhhhhhhhh.hhhhhhhhhhhhh...................eehhhhhhhhhhhhhh....hhhhhhhhhhhheeee...eeeeeeeeee.--....eeeeeeeeee...eeeeeeeeee...hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xa7 A   4 ITDYNYKKPL----QILDKSKIFGSNSGSFVmYSmKKDKYYIYNEKESRKRYSPNsTYKIYLAmFGLDRHIINDENSRmSWNHKHYPFDAWNKEQDLNTAmQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWmEDSLKISNLEQVIVFKNmmEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGI--GKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEmGV 251
                                    13    |   23        33 |  |   43        53     |  63   |    73        83        93       103|      113       123       133       143  |    153       163||     173       183       193       | -|      213       223       233       243     |  
                                    13   18               35-MSE                  59-PG1  67-MSE         82-MSE               104-MSE                                   146-MSE           164-MSE                              201  |                                          249-MSE
                                                             38-MSE                                                                                                                        165-MSE                                204                                               


Chain B from PDB  Type:PROTEIN  Length:240
 aligned with BLAR_STAAU | P18357 from UniProtKB/Swiss-Prot  Length:585

    Alignment length:245
                                   347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577     
           BLAR_STAAU   338 NYKKPLHNDYQILDKSKIFGSNSGSFVMYSMKKDKYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVL 582
               SCOP domains d1xa7b_ B: Regulato    ry prote in BlaR1                                                                                                                                                                                                              SCOP domains
               CATH domains 1xa7B00 B:8-252 DD-    peptidas e/beta-lactamase superfamily                                                                                                                                                                                          CATH domains
           Pfam domains (1) -------------------    Transpep tidase-1xa7B01 B:31-247                                                                                                                                                                                         ----- Pfam domains (1)
           Pfam domains (2) -------------------    Transpep tidase-1xa7B02 B:31-247                                                                                                                                                                                         ----- Pfam domains (2)
         Sec.struct. author ...................----.eeeeee.-..eeeee.......ee.hhhhhhhhhhhhhhhh..................hhhhh...hhhhhhhh.hhhhhhhhhhh.hhhhhhhhhhhh....................eehhhhhhhhhhhhhh....hhhhhhhhhhhheeee...eeeeeeeeeeee..eeeeeeeeeeeee...eeeeeeee.....hhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1xa7 B   8 NYKKPLHNDYQILDKSKIF----GSFVmYSm-KDKYYIYNEKESRKRYSPNsTYKIYLAmFGLDRHIINDENSRmSWNHKHYPFDAWNKEQDLNTAmQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWmEDSLKISNLEQVIVFKNmmEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEmGVL 252
                                    17        |-   |   |37| |     47        57 |      67        77    |   87        97      |107       117       127       137       147       157      |167       177       187       197       207       217       227       237       247 |   
                                             26   31   |  | |                 59-PG1  67-MSE         82-MSE               104-MSE                                   146-MSE           164-MSE                                                                              249-MSE
                                                      35-MSE|                                                                                                                          165-MSE                                                                                   
                                                         38-MSE                                                                                                                                                                                                                  
                                                           40
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Multi-domain proteins (alpha and beta) (2421)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: Beta-lactamase (210)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (BLAR_STAAU | P18357)
molecular function
    GO:0008658    penicillin binding    Interacting selectively and non-covalently with penicillin, any antibiotic that contains the condensed beta-lactamthiazolidine ring system.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PG1  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1xa7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1xa7)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1xa7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BLAR_STAAU | P18357
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  BLAR_STAAU | P18357
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BLAR_STAAU | P18357: 1xa1 1xkz 3q81 3q82 3uy6

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1XA7)