|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1X9A) |
Sites (0, 0)| (no "Site" information available for 1X9A) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1X9A) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1X9A) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1X9A) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1X9A) |
Exons (0, 0)| (no "Exon" information available for 1X9A) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:87 aligned with Q9X074_THEMA | Q9X074 from UniProtKB/TrEMBL Length:87 Alignment length:87 10 20 30 40 50 60 70 80 Q9X074_THEMA 1 MALVLVKYGTDHPVEKLKIRSAKAEDKIVLIQNGVFWALEELETPAKVYAIKDDFLARGYSEEDSKVPLITYSEFIDLLEGEEKFIG 87 SCOP domains d1x9aa_ A: Hypothetical protein TM0979 SCOP domains CATH domains 1x9aA00 A:1-87 [code=3.40.1260.10, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 1x9a A 1 MALVLVKYGTDHPVEKLKIRSAKAEDKIVLIQNGVFWALEELETPAKVYAIKDDFLARGYSEEDSKVPLITYSEFIDLLEGEEKFIG 87 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:87 aligned with Q9X074_THEMA | Q9X074 from UniProtKB/TrEMBL Length:87 Alignment length:87 10 20 30 40 50 60 70 80 Q9X074_THEMA 1 MALVLVKYGTDHPVEKLKIRSAKAEDKIVLIQNGVFWALEELETPAKVYAIKDDFLARGYSEEDSKVPLITYSEFIDLLEGEEKFIG 87 SCOP domains d1x9ab_ B: Hypothetical protein TM0979 SCOP domains CATH domains 1x9aB00 B:201-287 [code=3.40.1260.10, no name defined] CATH domains Pfam domains (1) ------------DsrH-1x9aB01 B:213-286 - Pfam domains (1) Pfam domains (2) ------------DsrH-1x9aB02 B:213-286 - Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 1x9a B 201 MALVLVKYGTDHPVEKLKIRSAKAEDKIVLIQNGVFWALEELETPAKVYAIKDDFLARGYSEEDSKVPLITYSEFIDLLEGEEKFIG 287 210 220 230 240 250 260 270 280
|
||||||||||||||||||||
SCOP Domains (1, 2)| NMR Structure |
CATH Domains (1, 2)| NMR Structure |
Pfam Domains (1, 2)| NMR Structure |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A,B (Q9X074_THEMA | Q9X074)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|