|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1X93) |
(no "Site" information available for 1X93) |
(no "SS Bond" information available for 1X93) |
(no "Cis Peptide Bond" information available for 1X93) |
(no "SAP(SNP)/Variant" information available for 1X93) |
(no "PROSITE Motif" information available for 1X93) |
(no "Exon" information available for 1X93) |
NMR StructureChain A from PDB Type:PROTEIN Length:43 aligned with O25010_HELPY | O25010 from UniProtKB/TrEMBL Length:73 Alignment length:43 40 50 60 70 O25010_HELPY 31 TRAVSLYFSDEQYQKLEKMANEEEESVGSYIKRYILKALRKIE 73 SCOP domains d1x93a1 A:31-73 SCOP domains CATH domains ------------------------------------------- CATH domains Pfam domains ------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------- PROSITE Transcript ------------------------------------------- Transcript 1x93 A 31 TRAVSLYFSDEQYQKLEKMANEEEESVGSYIKRYILKALRKIE 73 40 50 60 70 Chain B from PDB Type:PROTEIN Length:43 aligned with O25010_HELPY | O25010 from UniProtKB/TrEMBL Length:73 Alignment length:43 40 50 60 70 O25010_HELPY 31 TRAVSLYFSDEQYQKLEKMANEEEESVGSYIKRYILKALRKIE 73 SCOP domains d1x93b_ B: Uncharacterized protein HP0222 SCOP domains CATH domains ------------------------------------------- CATH domains Pfam domains (1) --RHH_1-1x93B01 B:33-71 -- Pfam domains (1) Pfam domains (2) --RHH_1-1x93B02 B:33-71 -- Pfam domains (2) SAPs(SNPs) ------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------- PROSITE Transcript ------------------------------------------- Transcript 1x93 B 31 TRAVSLYFSDEQYQKLEKMANEEEESVGSYIKRYILKALRKIE 73 40 50 60 70
|
NMR Structure |
(no "CATH Domain" information available for 1X93) |
NMR Structure |
NMR Structure(hide GO term definitions) Chain A,B (O25010_HELPY | O25010)
|
|
|
|
|
|
|