1X50 - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE C-TERMINAL GAL-BIND LECTIN DOMAIN FROM HUMAN GALECTIN-4

Authors :   T. Tomizawa, T. Kigawa, K. Saito, S. Koshiba, M. Inoue, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   15 May 05 (Deposition) - 15 Nov 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Gal-Bind Lectin, Galectin, Sugar Binding, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Tomizawa, T. Kigawa, K. Saito, S. Koshiba, M. Inoue, S. Yokoyama
Solution Structure Of The C-Terminal Gal-Bind Lectin Domain From Human Galectin-4
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - GALECTIN-4
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P040607-12
	Expression System Vector Type	:	PLASMID
	Fragment	:	GAL-BINDING_LECTIN DOMAIN
	Gene	:	LGALS4
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS
	Synonym	:	LACTOSE-BINDING LECTIN 4, L-36 LACTOSE BINDING PROTEIN, L36LBP, ANTIGEN NY-CO-27


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1X50)

(no "Site" information available for 1X50)

(no "SS Bond" information available for 1X50)

NMR Structure

No.	Model	Residues
1	1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20	Val A:27	-	Pro A:28

(no "SAP(SNP)/Variant" information available for 1X50)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GALECTIN	PS51304	Galactoside-binding lectin (galectin) domain profile.	LEG4_HUMAN	19-150 194-323	1	- A:29-158

NMR Structure (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000307751	1	ENSE00001142407	chr19:39303740-39303482	259	LEG4_HUMAN	1-15	15	0	-	-
1.2	ENST00000307751	2	ENSE00001142396	chr19:39303159-39303071	89	LEG4_HUMAN	16-45	30	0	-	-
1.3	ENST00000307751	3	ENSE00001142389	chr19:39299588-39299384	205	LEG4_HUMAN	45-113	69	1	A:1-7 (gaps)	17
1.4	ENST00000307751	4	ENSE00001142380	chr19:39297235-39297101	135	LEG4_HUMAN	114-158	45	0	-	-
1.5	ENST00000307751	5	ENSE00001142372	chr19:39294535-39294509	27	LEG4_HUMAN	159-167	9	0	-	-
1.6	ENST00000307751	6	ENSE00001142366	chr19:39294420-39294382	39	LEG4_HUMAN	168-180	13	1	A:8-15	8
1.7	ENST00000307751	7	ENSE00001142360	chr19:39294191-39294162	30	LEG4_HUMAN	181-190	10	1	A:16-25	10
1.8	ENST00000307751	8	ENSE00001142353	chr19:39293044-39292956	89	LEG4_HUMAN	191-220	30	1	A:26-55	30
1.9	ENST00000307751	9	ENSE00001142346	chr19:39292797-39292632	166	LEG4_HUMAN	220-275	56	1	A:55-110	56
1.10	ENST00000307751	10	ENSE00001233895	chr19:39292550-39292312	239	LEG4_HUMAN	276-323	48	1	A:111-158	48

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:164
 aligned with LEG4_HUMAN | P56470 from UniProtKB/Swiss-Prot  Length:323

    Alignment length:248
                                                                                                                                                                                                                                                                           323      
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321 |      
           LEG4_HUMAN    82 GKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI------   -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------1x50A01 A:16-164  [code=2.60.120.200, no name defined]                                                                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......----------.--------------------------------------------------------------------------..............ee.....eeee........eeeeeeee.......eeeeee........eeee........eee.ee..ee...ee...........eeeeeeee...eeeeee...eeeeee....hhhhh.eeeeee..eeeeeeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GALECTIN  PDB: - UniProt: 19-150                                     -------------------------------------------GALECTIN  PDB: A:29-158 UniProt: 194-323                                                                                          ------ PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:1-7 (gaps)     Exon 1.4  PDB: - UniProt: 114-158            Exon 1.5 Exon 1.6     Exon 1.7  Exon 1.8  PDB: A:26-55        -------------------------------------------------------Exon 1.10  PDB: A:111-158 UniProt: 276-323      ------ Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: A:55-110 UniProt: 220-275                ------------------------------------------------------ Transcript 1 (2)
                 1x50 A   1 GSSGSS----------G--------------------------------------------------------------------------HQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQISGPSSG 164
                                 |   -      |  -         -         -         -         -         -         -         - |      16        26        36        46        56        66        76        86        96       106       116       126       136       146       156        
                                 6          7                                                                          8

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1X50)

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Jelly Rolls (1293)

Homologous Superfamily: [code=2.60.120.200, no name defined] (421)

Human (Homo sapiens) (49)

1x50A01

A:16-164

(no "Pfam Domain" information available for 1X50)

NMR Structure(hide GO term definitions)

Chain A (LEG4_HUMAN | P56470)

molecular function
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0016936	galactoside binding	Interacting selectively and non-covalently with any glycoside in which the sugar group is galactose.
biological process
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1x50)

	Sites
(no "Sites" information available for 1x50)

	Cis Peptide Bonds
		Val A:27 - Pro A:28	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1x50
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LEG4_HUMAN \| P56470
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LEG4_HUMAN \| P56470
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	LEG4_HUMAN \| P56470	:	4xzp 4ylz 4ym0 4ym1 4ym2 4ym3 5cbl 5duu 5duv 5duw 5dux

(no "Related Entries Specified in the PDB File" available for 1X50)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 20)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (6, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File