Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF PI1-3P
 
Authors :  G. Ferrat
Date :  24 Feb 05  (Deposition) - 19 Apr 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Ionic Channel Inhibitor, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Carrega, A. Mosbah, G. Ferrat, C. Beeton, N. Andreotti, P. Mansuelle, H. Darbon, M. De Waard, J. M. Sabatier
The Impact Of The Fourth Disulfide Bridge In Scorpion Toxins Of The Alpha-Ktx6 Subfamily
Proteins V. 61 1010 2005
PubMed-ID: 16247791  |  Reference-DOI: 10.1002/PROT.20681
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - POTASSIUM CHANNEL BLOCKING TOXIN 1
    ChainsA
    Organism CommonEMPEROR SCORPION
    Organism ScientificPANDINUS IMPERATOR
    Organism Taxid55084
    SynonymPI1-3P, PI1, PI-1, PITX-K-GAMMA, ALPHA-KTX 6.1

 Structural Features

(-) Chains, Units

  
NMR Structure 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

NMR Structure (1, 2)
No.NameCountTypeFull Name
1ABA2Mod. Amino AcidALPHA-AMINOBUTYRIC ACID

(-) Sites  (0, 0)

(no "Site" information available for 1WZ5)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:4 -A:25
2A:10 -A:30
3A:14 -A:32

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1WZ5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1WZ5)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SCORP_SHORT_TOXINPS01138 Scorpion short toxins signature.KAX61_PANIM10-32  1A:10-32

(-) Exons   (0, 0)

(no "Exon" information available for 1WZ5)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:35
 aligned with KAX61_PANIM | Q10726 from UniProtKB/Swiss-Prot  Length:35

    Alignment length:35
                                    10        20        30     
           KAX61_PANIM    1 LVKCRGTSDCGRPCQQQTGCPNSKCINRMCKCYGC 35
               SCOP domains d1wz5a_ A: automated matches        SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains -Toxin_2-1wz5A01 A:2-33          -- Pfam domains
         Sec.struct. author .........hhhhhhhhh.....eee..eee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ---------SCORP_SHORT_TOXIN      --- PROSITE
                 Transcript ----------------------------------- Transcript
                  1wz5 A  1 LVKCRGTSDCGRPCQQQTGaPNSKCINRMCKCYGa 35
                                    10        20        30    |
                                              20-ABA         35-ABA

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1WZ5)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A   (KAX61_PANIM | Q10726)
molecular function
    GO:0008200    ion channel inhibitor activity    Stops, prevents, or reduces the activity of an ion channel.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ABA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1wz5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1wz5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1wz5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAX61_PANIM | Q10726
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KAX61_PANIM | Q10726
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1WZ5)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1WZ5)