|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1WVK) |
Sites (0, 0)| (no "Site" information available for 1WVK) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1WVK) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WVK) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WVK) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1WVK) |
Exons (0, 0)| (no "Exon" information available for 1WVK) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:86 aligned with Y2309_ARATH | O64818 from UniProtKB/Swiss-Prot Length:78 Alignment length:86 1 |2 12 22 32 42 52 62 72 Y2309_ARATH - --------MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAEAKHPKADVVACFPHLKK 78 SCOP domains d1wvka_ A: Expressed protein At2g23090/F21P24.15 SCOP domains CATH domains 1wvkA00 A:1-86 At2g23090 CATH domains Pfam domains ----------4F5-1wvkA01 A:11-45 ----------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------- Transcript 1wvk A 1 GHHHHHHLEGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAEAKHPKADVVACFPHLKK 86 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (Y2309_ARATH | O64818)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|