|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric/Biological Unit (1, 3)
|
Sites (0, 0)| (no "Site" information available for 1WV9) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1WV9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WV9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WV9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1WV9) |
Exons (0, 0)| (no "Exon" information available for 1WV9) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:87 aligned with Q5SKN0_THET8 | Q5SKN0 from UniProtKB/TrEMBL Length:94 Alignment length:89 11 21 31 41 51 61 71 81 Q5SKN0_THET8 2 RKVRPEELPALLEEGVLVVDVRPADRRSTPLPFAAEWVPLEKIQKGEHGLPRRPLLLVCEKGLLSQVAALYLEAEGYEAMSLEGGLQAL 90 SCOP domains ----------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1wv9 A 2 RKVRPEELPALLEEGVLVVDVRPA--RSTPLPFAAEWVPLEKIQKGEHGLPRRPLLLVCEKGLLSQVAALYLEAEGYEAmSLEGGLQAL 90 11 21 | | 31 41 51 61 71 81 25 28 81-MSE Chain B from PDB Type:PROTEIN Length:86 aligned with Q5SKN0_THET8 | Q5SKN0 from UniProtKB/TrEMBL Length:94 Alignment length:89 10 20 30 40 50 60 70 80 Q5SKN0_THET8 1 MRKVRPEELPALLEEGVLVVDVRPADRRSTPLPFAAEWVPLEKIQKGEHGLPRRPLLLVCEKGLLSQVAALYLEAEGYEAMSLEGGLQA 89 SCOP domains ----------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1wv9 B 1 mRKVRPEELPALLEEGVLVVDVRPA---STPLPFAAEWVPLEKIQKGEHGLPRRPLLLVCEKGLLSQVAALYLEAEGYEAmSLEGGLQA 89 | 10 20 | 30 40 50 60 70 80| 1-MSE 25 29 81-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 1WV9) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WV9) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1WV9) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1WV9)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|