|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (0, 0)| (no "Site" information available for 1WV8) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1WV8) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WV8) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1WV8) |
Exons (0, 0)| (no "Exon" information available for 1WV8) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:71 aligned with Q5SJJ5_THET8 | Q5SJJ5 from UniProtKB/TrEMBL Length:73 Alignment length:71 11 21 31 41 51 61 71 Q5SJJ5_THET8 2 RTLKVQALWDGEAGVWVAESDDVPGLATEAATLEELLAKLAVMVPELLEENGVALELPVELRLEATRPLVF 72 SCOP domains d1wv8a1 A:2-72 Hypothetical protein TTHA1013 SCOP domains CATH domains ----------------------------------------------------------------------- CATH domains Pfam domains --DUF1902-1wv8A01 A:4-57 --------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 1wv8 A 2 RTLKVQALWDGEAGVWVAESDDVPGLATEAATLEELLAKLAVmVPELLEENGVALELPVELRLEATRPLVF 72 11 21 31 41 | 51 61 71 44-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WV8) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1WV8)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|