|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1WRF) |
Sites (0, 0)| (no "Site" information available for 1WRF) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (1, 11)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (4, 4)
NMR Structure (4, 4)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1WRF) |
Exons (0, 0)| (no "Exon" information available for 1WRF) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:129 aligned with ALL2_DERFA | Q00855 from UniProtKB/Swiss-Prot Length:146 Alignment length:129 27 37 47 57 67 77 87 97 107 117 127 137 ALL2_DERFA 18 DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 146 SCOP domains d1wrfa_ A: Major mite allergen SCOP domains CATH domains 1wrfA00 A:1-129 [code=2.60.40.770, no name defined] CATH domains Pfam domains E1_DerP2_DerF2-1wrfA01 A:1-125 ---- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------V-----------A----------------------V-------------A---- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript 1wrf A 1 DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 129 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (ALL2_DERFA | Q00855)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|