Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PRIB
 
Authors :  S. Shioi, T. Ose, K. Maenaka, Y. Abe, D. Kohda, T. Katayama, T. Ueda
Date :  13 Aug 04  (Deposition) - 25 Jan 05  (Release) - 05 Dec 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  A,D  (1x)
Biol. Unit 3:  B (1x),C (1x)
Keywords :  Oligonucleotide Binding Fold, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Shioi, T. Ose, K. Maenaka, M. Shiroishi, Y. Abe, D. Kohda, T. Katayama, T. Ueda
Crystal Structure Of A Biologically Functional Form Of Prib From Escherichia Coli Reveals A Potential Single-Stranded Dna-Binding Site
Biochem. Biophys. Res. Commun. V. 326 766 2005
PubMed-ID: 15607735  |  Reference-DOI: 10.1016/J.BBRC.2004.11.104

(-) Compounds

Molecule 1 - PRIMOSOMAL REPLICATION PROTEIN N
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET22B(+)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificESCHERICHIA COLI
    Organism Taxid83333
    StrainK12
    SynonymPRIMOSOMAL PROTEIN B, PRIB

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)ABCD
Biological Unit 2 (1x)A  D
Biological Unit 3 (1x) B (1x)C (1x) 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 8)

Asymmetric Unit (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
1MSE2Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1WOC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1WOC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1WOC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1WOC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1WOC)

(-) Exons   (0, 0)

(no "Exon" information available for 1WOC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:99
 aligned with PRIB_ECOLI | P07013 from UniProtKB/Swiss-Prot  Length:104

    Alignment length:99
                                    11        21        31        41        51        61        71        81        91         
           PRIB_ECOLI     2 TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELI 100
               SCOP domains d1woca_ A: automated matches                                                                        SCOP domains
               CATH domains 1wocA00 A:2-100 Nucleic acid-binding proteins                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeeeeeee.....eeeeeeeeeeeeeee..eeeeeeeeeeeeee.hhhhhhhhhh....eeeeeeeeeeee.....eeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------- Transcript
                 1woc A   2 TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQmPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKmVLHAEQIELI 100
                                    11        21        31        41        51        61        71        81        91         
                                                                           50-MSE                                  90-MSE      

Chain B from PDB  Type:PROTEIN  Length:99
 aligned with PRIB_ECOLI | P07013 from UniProtKB/Swiss-Prot  Length:104

    Alignment length:99
                                    11        21        31        41        51        61        71        81        91         
           PRIB_ECOLI     2 TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELI 100
               SCOP domains d1wocb_ B: automated matches                                                                        SCOP domains
               CATH domains 1wocB00 B:2-100 Nucleic acid-binding proteins                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee....eeee.....eeeeeeeeeeeeeee..eeeeeeeeeeeeee...hhhhhh......eeeeeeeeeeee.....eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------- Transcript
                 1woc B   2 TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQmPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKmVLHAEQIELI 100
                                    11        21        31        41        51        61        71        81        91         
                                                                           50-MSE                                  90-MSE      

Chain C from PDB  Type:PROTEIN  Length:100
 aligned with PRIB_ECOLI | P07013 from UniProtKB/Swiss-Prot  Length:104

    Alignment length:100
                                    11        21        31        41        51        61        71        81        91       101
           PRIB_ECOLI     2 TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELID 101
               SCOP domains d1wocc_ C: automated matches                                                                         SCOP domains
               CATH domains 1wocC00 C:2-101 Nucleic acid-binding proteins                                                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeeeeeeee.....eeeeeeeeeeeeeee..eeeeeeeeeeeeee.hhhhhhhh......eeeeeeeeeeee.....eeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------- Transcript
                 1woc C   2 TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQmPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKmVLHAEQIELID 101
                                    11        21        31        41        51        61        71        81        91       101
                                                                           50-MSE                                  90-MSE       

Chain D from PDB  Type:PROTEIN  Length:99
 aligned with PRIB_ECOLI | P07013 from UniProtKB/Swiss-Prot  Length:104

    Alignment length:99
                                    11        21        31        41        51        61        71        81        91         
           PRIB_ECOLI     2 TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELI 100
               SCOP domains d1wocd_ D: automated matches                                                                        SCOP domains
               CATH domains 1wocD00 D:2-100 Nucleic acid-binding proteins                                                       CATH domains
           Pfam domains (1) SSB-1wocD01 D:2-100                                                                                 Pfam domains (1)
           Pfam domains (2) SSB-1wocD02 D:2-100                                                                                 Pfam domains (2)
           Pfam domains (3) SSB-1wocD03 D:2-100                                                                                 Pfam domains (3)
           Pfam domains (4) SSB-1wocD04 D:2-100                                                                                 Pfam domains (4)
         Sec.struct. author .eeeeeeeeeeeeeeeee.....eeeeeeeeeeee........eeeeeeeeeee.....hhhhhh....eeeeeeeeeee.......eeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------- Transcript
                 1woc D   2 TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQmPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKmVLHAEQIELI 100
                                    11        21        31        41        51        61        71        81        91         
                                                                           50-MSE                                  90-MSE      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: OB (224)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (PRIB_ECOLI | P07013)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003697    single-stranded DNA binding    Interacting selectively and non-covalently with single-stranded DNA.
biological process
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006270    DNA replication initiation    The process in which DNA-dependent DNA replication is started; this involves the separation of a stretch of the DNA double helix, the recruitment of DNA polymerases and the initiation of polymerase action.
    GO:0006269    DNA replication, synthesis of RNA primer    The synthesis of a short RNA polymer, usually 4-15 nucleotides long, using one strand of unwound DNA as a template; the RNA then serves as a primer from which DNA polymerases extend synthesis.
    GO:0006276    plasmid maintenance    The maintenance of the integrity of extrachromosomal plasmid DNA; includes processes that ensure plasmids are retained in the daughter cells after cell division.
cellular component
    GO:1990077    primosome complex    Any of a family of protein complexes that form at the origin of replication or stalled replication forks and function in replication primer synthesis in all organisms. Early complexes initiate double-stranded DNA unwinding. The core unit consists of a replicative helicase and a primase. The helicase further unwinds the DNA and recruits the polymerase machinery. The primase synthesizes RNA primers that act as templates for complementary stand replication by the polymerase machinery. The primosome contains a number of associated proteins and protein complexes and contributes to the processes of replication initiation, lagging strand elongation, and replication restart.
    GO:0030894    replisome    A multi-component enzymatic machine at the replication fork which mediates DNA replication. Includes DNA primase, one or more DNA polymerases, DNA helicases, and other proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1woc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1woc)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1woc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PRIB_ECOLI | P07013
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PRIB_ECOLI | P07013
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PRIB_ECOLI | P070131txy 1v1q 2ccz 2pnh

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1WOC)