|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
Asymmetric/Biological Unit (1, 4)
|
Sites (0, 0)| (no "Site" information available for 1WNA) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1WNA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WNA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WNA) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1WNA) |
Exons (0, 0)| (no "Exon" information available for 1WNA) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:127 aligned with Q5SI52_THET8 | Q5SI52 from UniProtKB/TrEMBL Length:131 Alignment length:127 10 20 30 40 50 60 70 80 90 100 110 120 Q5SI52_THET8 1 MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGLLLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYL 127 SCOP domains d1wnaa_ A: automated matches SCOP domains CATH domains -1wnaA00 A:2-127 hypothetical protein tt1805 CATH domains Pfam domains -------------DUF3197-1wnaA01 A:14-126 - Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript 1wna A 1 mVRVGmRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGLLLAQGARRFYEAVVSPGEmTALLDLPPEELLKRVmAIANPTDPGIYL 127 | | 10 20 30 40 50 60 70 80 90 100 110 | 120 | | 99-MSE 115-MSE 1-MSE| 6-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1WNA)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|