|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1WJ0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WJ0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WJ0) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WJ0) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:58 aligned with SPL12_ARATH | Q9S7P5 from UniProtKB/Swiss-Prot Length:927 Alignment length:58 133 143 153 163 173 SPL12_ARATH 124 AICCQVDNCGADLSKVKDYHRRHKVCEIHSKATTALVGGIMQRFCQQCSRFHVLEEFD 181 SCOP domains d1wj0a_ A: SCOP domains CATH domains 1wj0A00 A:124-181 CATH domains Pfam domains --SBP-1wj0A01 A:126-181 Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ZF_SBP PDB: A:124-181 UniProt: 124-201 PROSITE Transcript ---------------------------------------------------------- Transcript 1wj0 A 124 AICCQVDNCGADLSKVKDYHRRHKVCEIHSKATTALVGGIMQRFCQQCSRFHVLEEFD 181 133 143 153 163 173
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (SPL12_ARATH | Q9S7P5)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|