|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1WIF) |
Sites (0, 0)| (no "Site" information available for 1WIF) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1WIF) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WIF) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WIF) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WIF) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:126 aligned with PDZD9_MOUSE | Q9D9M4 from UniProtKB/Swiss-Prot Length:266 Alignment length:144 10 20 30 40 50 60 70 80 90 100 110 120 130 140 PDZD9_MOUSE 1 MEKGSLKSKNEKEQLSKAKASVSSLNKVIQTKLTVGNLGLGLVVIQNGPYLQISHLINKGAAASDGILQPGDVLISVGHANVLGYTLREFLKLLQNITIGTVLQIKAYRGFLEIPQEWQDVYDLIPETKFPIPHTPKKTEPARE 144 SCOP domains d1wifa_ A: hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ---------------------------PDZ-1wifA01 A:28-106 -------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE --------------------------PDZ PDB: A:27-109 UniProt: 27-109 ----------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1wif A 1 GSSGSSGSKNEKEQLSKAKASVSSLNKVIQTKLTVGNLGLGLVVIQNGPYLQISHLINKGAAASDGILQPGDVLISVGHANVLGYTLREFLKLLQNITIGTVLQIKAYRGFLEIPQEWQD------------------SGPSSG 126 10 20 30 40 50 60 70 80 90 100 110 120 - 122 120 121
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1WIF) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (PDZD9_MOUSE | Q9D9M4)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|