|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1WEE) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WEE) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WEE) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WEE) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:72 aligned with Y1342_ARATH | Q9C810 from UniProtKB/Swiss-Prot Length:697 Alignment length:127 570 580 590 600 610 620 630 640 650 660 670 680 Y1342_ARATH 561 GSIDDSITLKFLVGTNGVIRIKGRCSKHGLLRYRMERGVDNWKVDCKCGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRCIELYSKKPKQSKKERGSSQVPKAGFVCRGESAAMGSG 687 SCOP domains d1w eea_ A: PHD finger protein At1g33420 SCOP domains CATH domains 1we eA00 A:1-72 Zinc/RING finger domain, C3HC4 (zinc finger) CATH domains Pfam domains --------------------------------------------PHD-1weeA01 A:18-66 ---------------------------------- Pfam domains
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (Y1342_ARATH | Q9C810)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|