|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1WE9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WE9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WE9) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1WE9) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:64 aligned with ALFL4_ARATH | O81488 from UniProtKB/Swiss-Prot Length:255 Alignment length:97 255 170 180 190 200 210 220 230 240 250 | ALFL4_ARATH 161 SSSKRGSESRAKFSKPEPKDDEEEEEEGVEEEDEDEQGETQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKRARS-- - SCOP domains d1w e9 a_ A: PHD finger protein At5g26210 SCOP domains CATH domains 1we 9A 00 A:1-64 Zinc/RING finger domain, C3HC4 (zinc finger) CATH domains Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --------------------------------------ZF_PHD_2 PDB: A:8-58 UniProt: 199-251 ------ PROSITE (1) PROSITE (2) -----------------------------------------ZF_PHD_1 PDB: A:9-55 UniProt: 202-248 --------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------------- Transcript 1we9 A 1 GSS--GS-----------------------------SG--QCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKSGPSSG 64 | || - - - || -| 17 27 37 47 57 3 4| 6| 8 5 7
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1WE9) |
Gene Ontology (8, 8)|
NMR Structure(hide GO term definitions) Chain A (ALFL4_ARATH | O81488)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|