|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
Asymmetric/Biological Unit (1, 4)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1W2I) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1W2I) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1W2I) |
PROSITE Motifs (3, 6)
Asymmetric/Biological Unit (3, 6)
|
||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1W2I) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:90 aligned with ACYP_PYRHO | P84142 from UniProtKB/Swiss-Prot Length:91 Alignment length:90 11 21 31 41 51 61 71 81 91 ACYP_PYRHO 2 AIVRAHLKIYGRVQGVGFRWSMQREARKLGVNGWVRNLPDGSVEAVLEGDEERVEALIGWAHQGPPLARVTRVEVKWEQPKGEKGFRIVG 91 SCOP domains d1w2ia_ A: Acylphosphatase SCOP domains CATH domains ------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) ---ACYLPHOSPHATASE_3 PDB: A:5-91 UniProt: 5-91 PROSITE (1) PROSITE (2) --------ACYLPHOSPHA-------------ACYLPHOSPHATASE_2----------------------------------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------ Transcript 1w2i A 2 AIVRAHLKIYGRVQGVGFRWSMQREARKLGVNGWVRNLPDGSVEAVLEGDEERVEALIGWAHQGPPLARVTRVEVKWEQPKGEKGFRIVG 91 11 21 31 41 51 61 71 81 91 Chain B from PDB Type:PROTEIN Length:90 aligned with ACYP_PYRHO | P84142 from UniProtKB/Swiss-Prot Length:91 Alignment length:90 11 21 31 41 51 61 71 81 91 ACYP_PYRHO 2 AIVRAHLKIYGRVQGVGFRWSMQREARKLGVNGWVRNLPDGSVEAVLEGDEERVEALIGWAHQGPPLARVTRVEVKWEQPKGEKGFRIVG 91 SCOP domains d1w2ib_ B: Acylphosphatase SCOP domains CATH domains ------------------------------------------------------------------------------------------ CATH domains Pfam domains (1) Acylphosphatase-1w2iB01 B:2-90 - Pfam domains (1) Pfam domains (2) Acylphosphatase-1w2iB02 B:2-90 - Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) ---ACYLPHOSPHATASE_3 PDB: B:5-91 UniProt: 5-91 PROSITE (1) PROSITE (2) --------ACYLPHOSPHA-------------ACYLPHOSPHATASE_2----------------------------------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------ Transcript 1w2i B 2 AIVRAHLKIYGRVQGVGFRWSMQREARKLGVNGWVRNLPDGSVEAVLEGDEERVEALIGWAHQGPPLARVTRVEVKWEQPKGEKGFRIVG 91 11 21 31 41 51 61 71 81 91
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1W2I) |
Pfam Domains (1, 2)| Asymmetric/Biological Unit |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (ACYP_PYRHO | P84142)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|