|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| NMR Structure (2, 2) |
Sites (3, 3)
NMR Structure (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1VRF) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1VRF) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VRF) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1VRF) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:147 aligned with GLB4_GLYDI | P15447 from UniProtKB/Swiss-Prot Length:148 Alignment length:147 11 21 31 41 51 61 71 81 91 101 111 121 131 141 GLB4_GLYDI 2 GLSAAQRQVVASTWKDIAGSDNGAGVGKECFTKFLSAHHDIAAVFGFSGASDPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGYKHIKAEYFEPLGASLLSAMEHRIGGKMTAAAKDAWAAAYADISGALISGLQS 148 SCOP domains d1vrfa_ A: Glycera globin SCOP domains CATH domains 1vrfA00 A:1-147 Globins CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -GLOBIN PDB: A:2-143 UniProt: 3-144 ---- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1vrf A 1 GLSAAQRQVVASTWKDIAGSDNGAGVGKECFTKFLSAHHDMAAVFGFSGASDPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGNKHIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYADISGALISGLQS 147 10 20 30 40 50 60 70 80 90 100 110 120 130 140
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1VRF) |
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (GLB4_GLYDI | P15447)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|