|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (1, 9) Biological Unit 2 (1, 18) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1VMJ) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VMJ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1VMJ) |
Exons (0, 0)| (no "Exon" information available for 1VMJ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:139 aligned with Q9WZI2_THEMA | Q9WZI2 from UniProtKB/TrEMBL Length:139 Alignment length:139 10 20 30 40 50 60 70 80 90 100 110 120 130 Q9WZI2_THEMA 1 MKSYRKELWFHTKRRREFINITPLLEECVRESGIKEGLLLCNAMHITASVFINDDEPGLHHDFEVWLEKLAPEKPYSQYKHNDTGEDNADAHLKRTIMGREVVIAITDRKMDLGPWEQVFYGEFDGMRPKRVLVKIIGE 139 SCOP domains d1vmja_ A: Hypothetical protein TM0723 SCOP domains CATH domains 1vmjA00 A:1-139 Hypothetical protein CATH domains Pfam domains ------------------UPF0047-1vmjA01 A:19-137 -- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1vmj A 1 MKSYRKELWFHTKRRREFINITPLLEECVRESGIKEGLLLCNAMHITASVFINDDEPGLHHDFEVWLEKLAPEKPYSQYKHNDTGEDNADAHLKRTIMGREVVIAITDRKMDLGPWEQVFYGEFDGMRPKRVLVKIIGE 139 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1VMJ)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|