|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric/Biological Unit (1, 3)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VKB) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1VKB) |
Exons (0, 0)| (no "Exon" information available for 1VKB) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:148 aligned with GGACT_MOUSE | Q923B0 from UniProtKB/Swiss-Prot Length:149 Alignment length:151 1 | 8 18 28 38 48 58 68 78 88 98 108 118 128 138 148 GGACT_MOUSE - --MAHIFVYGTLKRGQPNHKVMLDHSHGLAAFRGRGCTVESFPLVIAGEHNIPWLLYLPGKGHCVTGEIYEVDEQMLRFLDDFEDCPSMYQRTALQVQVLEWEGDGDPGDSVQCFVYTTATYAPEWLFLPYHESYDSEGPHGLRYNPRENR 149 SCOP domains d1vkba_ A: Hypothetical protein LOC223267 SCOP domains CATH domains 1vkbA00 A:-1-149 Hypothetical upf0131 protein ytfp CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1vkb A -1 HHMAHIFVYGTLKRGQPNHKVMLDHSHGLAAFRGRGCTVESFPLVIAGEHNIPWLLYLPGKGHCVTGEIYEVDEQMLRFLDDFEDCPSMYQRTALQVQVLEWE---DPGDSVQCFVYTTATYAPEWLFLPYHESYDSEGPHGLRYNPRENR 149 8 18 28 38 48 58 68 78 88 98 | |108 118 128 138 148 101 105
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1VKB) |
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (GGACT_MOUSE | Q923B0)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|