1VJ1 - JenaLib

Title :   CRYSTAL STRUCTURE OF PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE FROM MUS MUSCULUS AT 2.10 A RESOLUTION

Authors :   Joint Center For Structural Genomics (Jcsg)

Date :   03 Dec 03 (Deposition) - 09 Dec 03 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym./Biol. Unit : A

Keywords :   Putative Nadph-Dependent Oxidoreductase, Structural Genomics, Jcsg, Psi, Protein Structure Initiative, Joint Center For Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   I. Levin, R. Schwarzenbacher, D. Mcmullan, P. Abdubek, E. Ambing, T. Biorac, J. Cambell, J. M. Canaves, H. J. Chiu, X. Dai, A. M. Deacon, M. Didonato, M. A. Elsliger, A. Godzik, C. Grittini, S. K. Grzechnik, E. Hampton, L. Jaroszewski, C. Karlak, H. E. Klock, E. Koesema, A. Kreusch, P. Kuhn, S. A. Lesley, T. M. Mcphillips, M. D. Miller, A. Morse, K. Moy, J. Ouyang, R. Page, K. Quijano, R. Reyes, A. Robb, E. Sims, G. Spraggon, R. C. Stevens, H. Van Den Bedem, J. Velasquez, J. Vincent, F. Von Delft, X. Wang, B. West, G. Wolf, Q. Xu, K. O. Hodgson J. Wooley, I. A. Wilson
Crystal Structure Of A Putative Nadph-Dependent Oxidoreductase (Gi: 18204011) From Mouse At 2. 10 A Resolution
Proteins V. 56 629 2004
PubMed-ID: 15229897 | Reference-DOI: 10.1002/PROT.20163

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 9)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:341
 aligned with PTGR2_MOUSE | Q8VDQ1 from UniProtKB/Swiss-Prot  Length:351

    Alignment length:353
                              1                                                                                                                                                                                                                                                                                                                                                              
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348   
          PTGR2_MOUSE     - --MIIQRVVLNSRPGKNGNPVAENFRVEEFSLPDALNEGQVQVRTLYLSVDPYMRCKMNEDTGTDYLAPWQLAQVADGGGIGVVEESKHQKLTKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGVQEKGHISAGSNQTMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNAVISQMNENSHIILCGQISQYSNDVPYPPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGILQLSQWFKEGKLKVKETMAKGLENMGVAFQSMMTGGNVGKQIVCISEDSSL 351
               SCOP domains d1vj1a1 A:-1-124,A:312-351 Putative zinc-binding alcohol dehydrogenase                                                        d1vj1a2 A:125-311 Putative zinc-binding alcohol dehydrogenase                                                                                                                              d1vj1a1 A:-1-124,A:312-351               SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------1vj1A02 A:133-313 NAD(P)-binding Rossmann-like Domain                                                                                                                                -------------------------------------- CATH domains
               Pfam domains -----------------------------------------------------------------------------------------------------------------------------------------------------------------------ADH_zinc_N-1vj1A01 A:166-283                                                                                          -------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee..........hhh.eeeeeeeee......eeeeeeeeeeehhhhhhhhh.................eeeeeeeeeee.........eeeeeeee...eeeee.hhheeehhhhhh.hhhhhhh..hhhhhhhhhhhhhhh........eeee......hhhhhhhhhhhh...eeeeee.hhhhhhhhhhhh...eeee....hhhhhhhhhh...eeeeee..hhhhhhhhhh.eeeeeeeee.------------....hhhhhhhhhhh..eeee.hhhhhhhhhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhh.....eeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1vj1 A  -1 HHmIIQRVVLNSRPGKNGNPVAENFRVEEFSLLDALNEGQVQVRTLYLSVDPYmRCKmNEDTGTDYLAPWQLAQVADGGGIGIVEESKHQKLAKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGmPGLTSLIGVQEKGHISAGSNQTmVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNTVISQmNENSHIILC------------PPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGILQLSQWFKEGKLKVKETVAKGLENmGVAFQSmmTGGNVGKQIVCISEDSSL 351
                              |      8        18        28        38        48   |   |58        68        78        88        98       108       118       128      |138       148       158       168       178       188       198       208       218       228       238     | 248    |    -       268       278       288       298       308       318      |328   ||  338       348   
                              |                                                 52-MSE                                                                            135-MSE                158-MSE                                                                               244-MSE  253          266                                                        325-MSE  ||                  
                              1-MSE                                                 56-MSE                                                                                                                                                                                                                                                                             332-MSE               
                                                                                                                                                                                                                                                                                                                                                                        333-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PTGR2_MOUSE | Q8VDQ1)

molecular function
	GO:0036132	13-prostaglandin reductase activity	Catalysis of the reaction: 15-keto-prostaglandin + NAD(P)H + H+ -> 13,14-dihydro-15-keto-prostaglandin + NAD(P)+. This reaction is the reduction of 15-keto-prostaglandin.
	GO:0047522	15-oxoprostaglandin 13-oxidase activity	Catalysis of the reaction: (5Z)-(15S)-11-alpha-hydroxy-9,15-dioxoprostanoate + NAD(P)+ -> (5Z)-(15S)-11-alpha-hydroxy-9,15-dioxoprosta-13-enoate + NAD(P)H + H+.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0019371	cyclooxygenase pathway	The chemical reactions and pathways by which prostaglandins are formed from arachidonic acid, and in which prostaglandin-endoperoxide synthase (cyclooxygenase) catalyzes the committed step in the conversion of arachidonic acid to the prostaglandin-endoperoxides PGG2 and PGH2.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006693	prostaglandin metabolic process	The chemical reactions and pathways involving prostaglandins, any of a group of biologically active metabolites which contain a cyclopentane ring due to the formation of a bond between two carbons of a fatty acid. They have a wide range of biological activities.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1vj1
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PTGR2_MOUSE \| Q8VDQ1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description