Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF RIBOSOMAL PROTEIN S2P
 
Authors :  Structural Genomix
Date :  01 Dec 03  (Deposition) - 30 Dec 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.65
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Structural Genomics, Ribosome (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Badger, J. M. Sauder, J. M. Adams, S. Antonysamy, K. Bain, M. G. Bergseid, S. G. Buchanan, M. D. Buchanan, Y. Batiyenko, J. A. Christopher, S. Emtage, A. Eroshkina, I. Feil, E. B. Furlong, K. S. Gajiwala, X. Gao, D. He, J. Hendle, A. Huber, K. Hoda, P. Kearins, C. Kissinger, B. Laubert, H. A. Lewis, J. Lin, K. Loomis, D. Lorimer, G. Louie, M. Maletic, C. D. Marsh, I. Miller, J. Molinari, H. J. Muller-Dieckmann, J. M. Newman, B. W. Noland, B. Pagarigan, F. Park, T. S. Peat, K. W. Post, S. Radojicic, A. Ramos, R. Romero, M. E. Rutter, W. E. Sanderson, K. D. Schwinn, J. Tresser, J. Winhoven, T. A. Wright, L. Wu, J. Xu, T. J. Harris
Structural Analysis Of A Set Of Proteins Resulting From A Bacterial Genomics Project
Proteins V. 60 787 2005
PubMed-ID: 16021622  |  Reference-DOI: 10.1002/PROT.20541
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 30S RIBOSOMAL PROTEIN S2P
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneRPS2P, AF1133
    Organism ScientificARCHAEOGLOBUS FULGIDUS
    Organism Taxid2234

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 12)

Asymmetric Unit (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 3)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 3)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 3)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE
Biological Unit 4 (1, 3)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1VI5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1VI5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1VI5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1VI5)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_S2_2PS00963 Ribosomal protein S2 signature 2.RS2_ARCFU115-139
 
 
 
  4A:115-139
B:115-139
C:115-139
D:115-139
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_S2_2PS00963 Ribosomal protein S2 signature 2.RS2_ARCFU115-139
 
 
 
  1A:115-139
-
-
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_S2_2PS00963 Ribosomal protein S2 signature 2.RS2_ARCFU115-139
 
 
 
  1-
B:115-139
-
-
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_S2_2PS00963 Ribosomal protein S2 signature 2.RS2_ARCFU115-139
 
 
 
  1-
-
C:115-139
-
Biological Unit 4 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_S2_2PS00963 Ribosomal protein S2 signature 2.RS2_ARCFU115-139
 
 
 
  1-
-
-
D:115-139

(-) Exons   (0, 0)

(no "Exon" information available for 1VI5)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:198
 aligned with RS2_ARCFU | O29132 from UniProtKB/Swiss-Prot  Length:197

    Alignment length:198
                                                                                                                                                                                                                          197     
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194  |     
            RS2_ARCFU     5 EYEYLVPPDDYLAAGVHIGTQIKTGDMKKFIFKVRQDGLYVLDIRKLDERIRVAAKFLSRYEPSKILLVAARQYAHKPVQMFSKVVGSDYIVGRFIPGTLTNPMLSEYREPEVVFVNDPAIDKQAVSEATAVGIPVVALCDSNNSSADVDLVIPTNNKGRRALAIVYWLLAREIAKIRGQDFTYSIEDFEAEL-----   -
               SCOP domains d1vi5a_ A: Ribosomal protein S2                                                                                                                                                                        SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhhhhhhhh...........hhh.eeee.....eeehhhhhhhhhhhhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhhh.eeee....................eeee.....hhhhhhhhhhhh..eeeee..........eeee....hhhhhhhhhhhhhhhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------RIBOSOMAL_S2_2           --------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1vi5 A   5 EYEYLVPPDDYLAAGVHIGTQIKTGDmKKFIFKVRQDGLYVLDIRKLDERIRVAAKFLSRYEPSKILLVAARQYAHKPVQmFSKVVGSDYIVGRFIPGTLTNPmLSEYREPEVVFVNDPAIDKQAVSEATAVGIPVVALCDSNNSSADVDLVIPTNNKGRRALAIVYWLLAREIAKIRGQDFTYSIEDFEAELEGGSH 202
                                    14        24      | 34        44        54        64        74        84|       94       104   |   114       124       134       144       154       164       174       184       194        
                                                     31-MSE                                                85-MSE                108-MSE                                                                                          

Chain B from PDB  Type:PROTEIN  Length:195
 aligned with RS2_ARCFU | O29132 from UniProtKB/Swiss-Prot  Length:197

    Alignment length:195
                                                                                                                                                                                                                           197 
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193   | 
            RS2_ARCFU     4 KEYEYLVPPDDYLAAGVHIGTQIKTGDMKKFIFKVRQDGLYVLDIRKLDERIRVAAKFLSRYEPSKILLVAARQYAHKPVQMFSKVVGSDYIVGRFIPGTLTNPMLSEYREPEVVFVNDPAIDKQAVSEATAVGIPVVALCDSNNSSADVDLVIPTNNKGRRALAIVYWLLAREIAKIRGQDFTYSIEDFEAEL-   -
               SCOP domains d1vi5b_ B: Ribosomal protein S2                                                                                                                                                                     SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhh...........hhhhh.eeee.....eeehhhhhhhhhhhhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhhh.eeee....................eeee.....hhhhhhhhhhhh..eeeee..........eeee....hhhhhhhhhhhhhhhhhhhhh.....hhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------RIBOSOMAL_S2_2           ----------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1vi5 B   4 KEYEYLVPPDDYLAAGVHIGTQIKTGDmKKFIFKVRQDGLYVLDIRKLDERIRVAAKFLSRYEPSKILLVAARQYAHKPVQmFSKVVGSDYIVGRFIPGTLTNPmLSEYREPEVVFVNDPAIDKQAVSEATAVGIPVVALCDSNNSSADVDLVIPTNNKGRRALAIVYWLLAREIAKIRGQDFTYSIEDFEAELE 198
                                    13        23       |33        43        53        63        73        83 |      93       103    |  113       123       133       143       153       163       173       183       193     
                                                      31-MSE                                                85-MSE                108-MSE                                                                                      

Chain C from PDB  Type:PROTEIN  Length:193
 aligned with RS2_ARCFU | O29132 from UniProtKB/Swiss-Prot  Length:197

    Alignment length:193
                                                                                                                                                                                                                         197 
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195 | 
            RS2_ARCFU     6 YEYLVPPDDYLAAGVHIGTQIKTGDMKKFIFKVRQDGLYVLDIRKLDERIRVAAKFLSRYEPSKILLVAARQYAHKPVQMFSKVVGSDYIVGRFIPGTLTNPMLSEYREPEVVFVNDPAIDKQAVSEATAVGIPVVALCDSNNSSADVDLVIPTNNKGRRALAIVYWLLAREIAKIRGQDFTYSIEDFEAEL-   -
               SCOP domains d1vi5c_ C: Ribosomal protein S2                                                                                                                                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhh...........hhh.eeee.....eeehhhhhhhhhhhhhhhhhhhhhh.eeeee.hhhhhhhhhhhhhhhh.eeee....................eeee.....hhhhhhhhhhhh..eeeee..........eeee....hhhhhhhhhhhhhhhhhhhhh.....hhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------RIBOSOMAL_S2_2           ----------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1vi5 C   6 YEYLVPPDDYLAAGVHIGTQIKTGDmKKFIFKVRQDGLYVLDIRKLDERIRVAAKFLSRYEPSKILLVAARQYAHKPVQmFSKVVGSDYIVGRFIPGTLTNPmLSEYREPEVVFVNDPAIDKQAVSEATAVGIPVVALCDSNNSSADVDLVIPTNNKGRRALAIVYWLLAREIAKIRGQDFTYSIEDFEAELE 198
                                    15        25     |  35        45        55        65        75        85        95       105  |    115       125       135       145       155       165       175       185       195   
                                                    31-MSE                                                85-MSE                108-MSE                                                                                      

Chain D from PDB  Type:PROTEIN  Length:192
 aligned with RS2_ARCFU | O29132 from UniProtKB/Swiss-Prot  Length:197

    Alignment length:192
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195  
            RS2_ARCFU     6 YEYLVPPDDYLAAGVHIGTQIKTGDMKKFIFKVRQDGLYVLDIRKLDERIRVAAKFLSRYEPSKILLVAARQYAHKPVQMFSKVVGSDYIVGRFIPGTLTNPMLSEYREPEVVFVNDPAIDKQAVSEATAVGIPVVALCDSNNSSADVDLVIPTNNKGRRALAIVYWLLAREIAKIRGQDFTYSIEDFEAEL 197
               SCOP domains d1vi5d_ D: Ribosomal protein S2                                                                                                                                                                  SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhh..........hhhhh.eeee.....eeehhhhhhhhhhhhhhhhh..hhh.eeeee.hhhhhhhhhhhhhhhh.eeee....................eeee.....hhhhhhhhhhhh..eeeee..........eeee....hhhhhhhhhhhhhhhhhhhhh.....hhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------RIBOSOMAL_S2_2           ---------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1vi5 D   6 YEYLVPPDDYLAAGVHIGTQIKTGDmKKFIFKVRQDGLYVLDIRKLDERIRVAAKFLSRYEPSKILLVAARQYAHKPVQmFSKVVGSDYIVGRFIPGTLTNPmLSEYREPEVVFVNDPAIDKQAVSEATAVGIPVVALCDSNNSSADVDLVIPTNNKGRRALAIVYWLLAREIAKIRGQDFTYSIEDFEAEL 197
                                    15        25     |  35        45        55        65        75        85        95       105  |    115       125       135       145       155       165       175       185       195  
                                                    31-MSE                                                85-MSE                108-MSE                                                                                     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1VI5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1VI5)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (RS2_ARCFU | O29132)
molecular function
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
    GO:0015935    small ribosomal subunit    The smaller of the two subunits of a ribosome.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1vi5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1vi5)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1vi5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RS2_ARCFU | O29132
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RS2_ARCFU | O29132
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RS2_ARCFU | O291321vi6

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1VI5)