|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 6)
Asymmetric/Biological Unit (1, 6)
|
Sites (0, 0)| (no "Site" information available for 1VI4) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1VI4) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1VI4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VI4) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1VI4) |
Exons (0, 0)| (no "Exon" information available for 1VI4) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:162 aligned with RRAAH_VIBCH | Q9KPK1 from UniProtKB/Swiss-Prot Length:161 Alignment length:162 161 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160| RRAAH_VIBCH 1 MRDITPDLCDKYESQVTLLNLPLQNFGQRSAFWGEIVTVRCYHDNSKVRDVLSQNGKGKVLVVDGHGSCHKALMGDQLAILAIKNDWEGVIIYGAVRDVVAMSEMDLGIKALGTSPFKTEKRGAGQVNVTLTMQNQIVEPGDYLYADWNGILMSETALDVA- - SCOP domains d1vi4a_ A: Hypothetical protein VC2366 SCOP domains CATH domains -1vi4A00 A:3-163 [code=3.50.30.40, no name defined] CATH domains Pfam domains Methyltransf_6-1vi4A01 A:2-154 --------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1vi4 A 2 mRDITPDLCDKYESQVTLLNLPLQNFGQRSAFWGEIVTVRCYHDNSKVRDVLSQNGKGKVLVVDGHGSCHKALmGDQLAILAIKNDWEGVIIYGAVRDVVAmSEmDLGIKALGTSPFKTEKRGAGQVNVTLTmQNQIVEPGDYLYADWNGILmSETALDVAE 163 | 11 21 31 41 51 61 71 | 81 91 101 | | 111 121 131 | 141 151 | 161 | 75-MSE 103-MSE 134-MSE 154-MSE 2-MSE 106-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RRAAH_VIBCH | Q9KPK1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|