Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE MAJOR NAD(P)H:FMN OXIDOREDUCTASE FROM VIBRIO FISCHERI
 
Authors :  H. Koike, H. Sasaki, T. Kobori, S. Zenno, K. Saigo, M. E. P. Murphy, E. T. A M. Tanokura
Date :  09 Jan 98  (Deposition) - 16 Feb 99  (Release) - 09 May 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Nad(P)H, Fmn, Oxidoreductase, Vibrio Fischeri, Bioluminescence (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Koike, H. Sasaki, T. Kobori, S. Zenno, K. Saigo, M. E. Murphy, E. T. Adman, M. Tanokura
1. 8 A Crystal Structure Of The Major Nad(P)H:Fmn Oxidoreductase Of A Bioluminescent Bacterium, Vibrio Fischeri: Overall Structure, Cofactor And Substrate-Analog Binding, And Comparison With Related Flavoproteins.
J. Mol. Biol. V. 280 259 1998
PubMed-ID: 9654450  |  Reference-DOI: 10.1006/JMBI.1998.1871
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NAD(P)H:FMN OXIDOREDUCTASE
    Atcc: ATCC 7744
    Chains: A, B
    Collection: ATCC 7744
    EC Number: 1.6.99.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PUC18
    Expression System Strain: JM 105
    Expression System Taxid: 562
    Organism Scientific: ALIIVIBRIO FISCHERI
    Organism Taxid: 668
    Synonym: FRASE I, FMN REDUCTASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:12 , TYR A:13 , THR A:14 , LYS A:16 , PHE A:72 , ASN A:73 , THR A:163 , MET A:164 , GLU A:165 , GLY A:166 , LYS A:206 , ARG A:208 , HOH A:471 , HOH A:474 , HOH A:475 , HOH A:476 , HOH A:477 , HOH A:529 , ALA B:40 , SER B:41 , SER B:42 , ASN B:44 , LEU B:145BINDING SITE FOR RESIDUE FMN A 454
2AC2SOFTWAREALA A:40 , SER A:41 , SER A:42 , ASN A:44 , LEU A:145 , ARG B:12 , TYR B:13 , THR B:14 , LYS B:16 , ASN B:73 , THR B:163 , MET B:164 , GLU B:165 , GLY B:166 , LYS B:206 , ARG B:208 , HOH B:480 , HOH B:481 , HOH B:482 , HOH B:488 , HOH B:489BINDING SITE FOR RESIDUE FMN B 454
3FM2UNKNOWNFMN B:454COFACTOR.
4FMNUNKNOWNFMN A:454COFACTOR.

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1VFR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1VFR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1VFR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1VFR)

(-) Exons   (0, 0)

(no "Exon" information available for 1VFR)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:217
 aligned with FRA1_ALIFS | P46072 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
           FRA1_ALIFS     2 THPIIHDLENRYTSKKYDPSKKVSQEDLAVLLEALRLSASSINSQPWKFIVIESDAAKQRMHDSFANMHQFNQPHIKACSHVILFANKLSYTRDDYDVVLSKAVADKRITEEQKEAAFASFKFVELNCDENGEHKAWTKPQAYLALGNALHTLARLNIDSTTMEGIDPELLSEIFADELKGYECHVALAIGYHHPSEDYNASLPKSRKAFEDVITIL 218
               SCOP domains d1vfra_ A: Flavin reductase P (NADPH:FMN oxidoreductase)                                                                                                                                                                  SCOP domains
               CATH domains 1vfrA00 A:2-218 NADH Oxidase                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh..............hhhhhhhhhhhh....hhh...eeeeee..hhhhhhhhhhh....hhhhhhhhh..eeeeeeee....hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh..eeeee....hhhhhhh.......eeeeeeeeee.......hhhh.......hhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1vfr A   2 THPIIHDLENRYTSKKYDPSKKVSQEDLAVLLEALRLSASSINSQPWKFIVIESDAAKQRMHDSFANMHQFNQPHIKACSHVILFANKLSYTRDDYDVVLSKAVADKRITEEQKEAAFASFKFVELNCDENGEHKAWTKPQAYLALGNALHTLARLNIDSTTMEGIDPELLSEIFADELKGYECHVALAIGYHHPSEDYNASLPKSRKAFEDVITIL 218
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       


Chain B from PDB  Type:PROTEIN  Length:217
 aligned with FRA1_ALIFS | P46072 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
           FRA1_ALIFS     2 THPIIHDLENRYTSKKYDPSKKVSQEDLAVLLEALRLSASSINSQPWKFIVIESDAAKQRMHDSFANMHQFNQPHIKACSHVILFANKLSYTRDDYDVVLSKAVADKRITEEQKEAAFASFKFVELNCDENGEHKAWTKPQAYLALGNALHTLARLNIDSTTMEGIDPELLSEIFADELKGYECHVALAIGYHHPSEDYNASLPKSRKAFEDVITIL 218
               SCOP domains d1vfrb_ B: Flavin reductase P (NADPH:FMN oxidoreductase)                                                                                                                                                                  SCOP domains
               CATH domains 1vfrB00 B:2-218 NADH Oxidase                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh..............hhhhhhhhhhhh....hhh...eeeeee..hhhhhhhhhhh.......hhhhhh..eeeeeeee....hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh..eeeee....hhhhhhh.......eeeeeeeeee.......hhhh.......hhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1vfr B   2 THPIIHDLENRYTSKKYDPSKKVSQEDLAVLLEALRLSASSINSQPWKFIVIESDAAKQRMHDSFANMHQFNQPHIKACSHVILFANKLSYTRDDYDVVLSKAVADKRITEEQKEAAFASFKFVELNCDENGEHKAWTKPQAYLALGNALHTLARLNIDSTTMEGIDPELLSEIFADELKGYECHVALAIGYHHPSEDYNASLPKSRKAFEDVITIL 218
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1VFR)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (FRA1_ALIFS | P46072)
molecular function
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0008218    bioluminescence    The production of light by certain enzyme-catalyzed reactions in cells.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    FM2  [ RasMol ]  +environment [ RasMol ]
    FMN  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1vfr)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1vfr
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FRA1_ALIFS | P46072
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.6.99.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FRA1_ALIFS | P46072
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FRA1_ALIFS | P46072: 1v5y 1v5z

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1VFR)