Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF TT1020 FROM THERMUS THERMOPHILUS HB8
 
Authors :  H. Wang, H. Sakai, C. Takemoto-Hori, T. Kaminishi, T. Terada, S. Kuramitsu, M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  15 Apr 04  (Deposition) - 11 Jan 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Structural Genomics, Signal Transducing Protein, Riken Structural Genomics/Proteomics Initiative, Rsgi, Nppsfa, National Project On Protein Structural And Functional Analyses, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Sakai, H. Wang, C. Takemoto-Hori, T. Kaminishi, H. Yamaguchi, Y. Kamewari, T. Terada, S. Kuramitsu, M. Shirouzu, S. Yokoyama
Crystal Structures Of The Signal Transducing Protein Glnk From Thermus Thermophilus Hb8
J. Struct. Biol. V. 149 99 2005
PubMed-ID: 15629661  |  Reference-DOI: 10.1016/J.JSB.2004.08.007
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NITROGEN REGULATORY PROTEIN P-II
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET26B(+)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    MutationYES
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274
    SynonymNITROGEN REGULATORY PROTEIN

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1VFJ)

(-) Sites  (0, 0)

(no "Site" information available for 1VFJ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1VFJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1VFJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1VFJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1VFJ)

(-) Exons   (0, 0)

(no "Exon" information available for 1VFJ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:116
 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL  Length:116

    Alignment length:116
                                    10        20        30        40        50        60        70        80        90       100       110      
         P83820_THETH     1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEAAVTPVQ 116
               SCOP domains d1vfja_ A: PII (product of glnB)                                                                                     SCOP domains
               CATH domains 1vfjA00 A:1-116  [code=3.30.70.120, no name defined]                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhh.....eeeeeeee.....hhhhhh........eeeeeeeeeehhhhhhhhhhhhhhhhh.......eeeeee..eeee......hhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 1vfj A   1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEAAVTPVQ 116
                                    10        20        30        40        50        60        70        80        90       100       110      

Chain B from PDB  Type:PROTEIN  Length:93
 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL  Length:116

    Alignment length:108
                                    10        20        30        40        50        60        70        80        90       100        
         P83820_THETH     1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108
               SCOP domains d1vfjb_ B: PII (product of glnB)                                                                             SCOP domains
               CATH domains 1vfjB00 B:1-108  [code=3.30.70.120, n               o name defined]                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhhh...eeeeeeeee.---------------...eeeeeeeeeehhhhhhhhhhhhhhhhh.......eeeeee..eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1vfj B   1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHG---------------MELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108
                                    10        20        30      |  -         -  |     60        70        80        90       100        
                                                               37              53                                                       

Chain C from PDB  Type:PROTEIN  Length:91
 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL  Length:116

    Alignment length:108
                                    10        20        30        40        50        60        70        80        90       100        
         P83820_THETH     1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108
               SCOP domains d1vfjc_ C: PII (product of glnB)                                                                             SCOP domains
               CATH domains 1vfjC00 C:1-108  [code=3.30.70.120,                  no name defined]                                        CATH domains
           Pfam domains (1) ---P-II-1vfjC01 C:4-105                                                                                  --- Pfam domains (1)
           Pfam domains (2) ---P-II-1vfjC02 C:4-105                                                                                  --- Pfam domains (2)
           Pfam domains (3) ---P-II-1vfjC03 C:4-105                                                                                  --- Pfam domains (3)
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhh....eeeeeeee.-----------------..eeeeeeeeeehhhhhhhhhhhhhhhhh.......eeeeee..eeee....ee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1vfj C   1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGH-----------------ELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108
                                    10        20        30     |   -         -   |    60        70        80        90       100        
                                                              36                54                                                      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Family: P-II (26)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (P83820_THETH | P83820)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0030234    enzyme regulator activity    Binds to and modulates the activity of an enzyme.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
    GO:0006808    regulation of nitrogen utilization    Any process that modulates the frequency, rate or extent of nitrogen utilization.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1vfj)
 
  Sites
(no "Sites" information available for 1vfj)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1vfj)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1vfj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  P83820_THETH | P83820
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  P83820_THETH | P83820
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        P83820_THETH | P838201ufl 1v3r 1v3s 1v9o

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1VFJ)