Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PH0226 PROTEIN FROM PYROCOCCUS HORIKOSHII OT3
 
Authors :  N. K. Lokanath, H. Yamamoto, N. Kunishima, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  26 Mar 04  (Deposition) - 24 May 05  (Release) - 13 May 08  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (2x)
Biol. Unit 2:  B  (2x)
Biol. Unit 3:  A  (1x)
Biol. Unit 4:  B  (1x)
Keywords :  Dimer, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Unknown Function, Nppsfa, National Project On Protein Structural And Functional Analyses (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. K. Lokanath, H. Yamamoto, N. Kunishima
Crystal Structure Of Ph0226 Protein From Pyrococcus Horikoshii Ot3
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN PH0226
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET11A
    Expression System StrainBL21 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificPYROCOCCUS HORIKOSHII
    Organism Taxid53953
    SynonymMETHYL TRANSFERASE, SAM DEPENDENT METHYLTRANSFERASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)A 
Biological Unit 2 (2x) B
Biological Unit 3 (1x)A 
Biological Unit 4 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 10)

Asymmetric Unit (2, 10)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE
2SAM2Ligand/IonS-ADENOSYLMETHIONINE
Biological Unit 1 (2, 10)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE
2SAM2Ligand/IonS-ADENOSYLMETHIONINE
Biological Unit 2 (2, 10)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE
2SAM2Ligand/IonS-ADENOSYLMETHIONINE
Biological Unit 3 (2, 5)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
2SAM1Ligand/IonS-ADENOSYLMETHIONINE
Biological Unit 4 (2, 5)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
2SAM1Ligand/IonS-ADENOSYLMETHIONINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:7 , TYR A:13 , GLN A:19 , TYR A:21 , ARG A:24 , ALA A:46 , GLY A:48 , ASP A:67 , ILE A:68 , SER A:69 , MSE A:72 , GLY A:92 , ASP A:93 , ALA A:94 , ILE A:110 , ASP A:111 , SER A:112 , HIS A:115 , PHE A:116 , HOH A:304 , HOH A:307 , HOH A:314 , HOH A:361BINDING SITE FOR RESIDUE SAM A 302
2AC2SOFTWARETYR B:7 , TYR B:13 , GLN B:19 , TYR B:21 , ARG B:24 , ALA B:46 , PHE B:52 , ASP B:67 , ILE B:68 , SER B:69 , MSE B:72 , GLY B:92 , ASP B:93 , ALA B:94 , ILE B:110 , ASP B:111 , SER B:112 , HIS B:115 , PHE B:116 , HOH B:303 , HOH B:306 , HOH B:309 , HOH B:310BINDING SITE FOR RESIDUE SAM B 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1VE3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1VE3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1VE3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1VE3)

(-) Exons   (0, 0)

(no "Exon" information available for 1VE3)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:212
 aligned with O57965_PYRHO | O57965 from UniProtKB/TrEMBL  Length:227

    Alignment length:226
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221      
         O57965_PYRHO     2 GFKEYYRVFPTYTDINSQEYRSRIETLEPLLMKYMKKRGKVLDLACGVGGFSFLLEDYGFEVVGVDISEDMIRKAREYAKSRESNVEFIVGDARKLSFEDKTFDYVIFIDSIVHFEPLELNQVFKEVRRVLKPSGKFIMYFTDLRELLPRLKESLVVGQKYWISKVIPDQEERTVVIEFKSEQDSFRVRFNVWGKTGVELLAKLYFTKEAEEKVGNYSYLTVYNPK 227
               SCOP domains d1ve3a1 A:2-227 Hypothetical protein PH0226                                                                                                                                                                                        SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh.......hhhhhhhhhhhhhhhhhh.....eeeee....hhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eeee............eeeeeee.hhhhhhhhhhhhhhhhhhhheeeeeeeeeeeehhhhhhhhh..---------..eeeee....eeeee.-----..eeeee..hhhhhhhhhh..eeeeeeeee...eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ve3 A   2 GFKEYYRVFPTYTDINSQEYRSRIETLEPLLmKYmKKRGKVLDLACGVGGFSFLLEDYGFEVVGVDISEDmIRKAREYAKSRESNVEFIVGDARKLSFEDKTFDYVIFIDSIVHFEPLELNQVFKEVRRVLKPSGKFImYFTDLRELLPRLKE---------ISKVIPDQEERTVVIEF-----SFRVRFNVWGKTGVELLAKLYFTKEAEEKVGNYSYLTVYNPK 227
                                    11        21        31 |  |   41        51        61        71|       81        91       101       111       121       131       141       151  |      -  |    171        |-    |  191       201       211       221      
                                                          33-MSE                                 72-MSE                                                             140-MSE       154       164             180   186                                         
                                                             36-MSE                                                                                                                                                                                           

Chain B from PDB  Type:PROTEIN  Length:226
 aligned with O57965_PYRHO | O57965 from UniProtKB/TrEMBL  Length:227

    Alignment length:226
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221      
         O57965_PYRHO     2 GFKEYYRVFPTYTDINSQEYRSRIETLEPLLMKYMKKRGKVLDLACGVGGFSFLLEDYGFEVVGVDISEDMIRKAREYAKSRESNVEFIVGDARKLSFEDKTFDYVIFIDSIVHFEPLELNQVFKEVRRVLKPSGKFIMYFTDLRELLPRLKESLVVGQKYWISKVIPDQEERTVVIEFKSEQDSFRVRFNVWGKTGVELLAKLYFTKEAEEKVGNYSYLTVYNPK 227
               SCOP domains d1ve3b_ B: Hypothetical protein PH0226                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------------------------------------Methyltransf_11-1ve3B01 B:43-140                                                                  --------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -----------------------------------------Methyltransf_11-1ve3B02 B:43-140                                                                  --------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.....eeeee....hhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh...eeee............eeeeeee.hhhhhhhhhhhhhhhhhhhheeeeeeeeeee.hhhhhhhhhhhhhhhhh.eeeeeeeee....eeeeeeee...eeeeeee..hhhhhhhhhhhhheeeeeeee...eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ve3 B   2 GFKEYYRVFPTYTDINSQEYRSRIETLEPLLmKYmKKRGKVLDLACGVGGFSFLLEDYGFEVVGVDISEDmIRKAREYAKSRESNVEFIVGDARKLSFEDKTFDYVIFIDSIVHFEPLELNQVFKEVRRVLKPSGKFImYFTDLRELLPRLKESLVVGQKYWISKVIPDQEERTVVIEFKSEQDSFRVRFNVWGKTGVELLAKLYFTKEAEEKVGNYSYLTVYNPK 227
                                    11        21        31 |  |   41        51        61        71|       81        91       101       111       121       131       141       151       161       171       181       191       201       211       221      
                                                          33-MSE                                 72-MSE                                                             140-MSE                                                                                   
                                                             36-MSE                                                                                                                                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1VE3)

(-) Pfam Domains  (1, 2)

Asymmetric Unit

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (O57965_PYRHO | O57965)
molecular function
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SAM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ve3)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ve3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O57965_PYRHO | O57965
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  O57965_PYRHO | O57965
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1VE3)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1VE3)