|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)| Asymmetric Unit (3, 5) Biological Unit 1 (2, 12) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1VE0) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VE0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1VE0) |
Exons (0, 0)| (no "Exon" information available for 1VE0) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:134 aligned with Q96YV5_SULTO | Q96YV5 from UniProtKB/TrEMBL Length:134 Alignment length:134 10 20 30 40 50 60 70 80 90 100 110 120 130 Q96YV5_SULTO 1 MKIISKEFTVKTRSRFDSIDITEQVSEAIKGINNGIAHVIVKHTTCAIIINEAESGLMKDFLNWAKKLVPPDGEFEHNIIDNNGHAHVISAIIGNSRVVPIIEGKLDLGTWQRIILLEFDGPRTRTVLVKSMGE 134 SCOP domains d1ve0a_ A: automated matches SCOP domains CATH domains -1ve0A00 A:2-134 Hypothetical protein CATH domains Pfam domains ------------------UPF0047-1ve0A01 A:19-132 -- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript 1ve0 A 1 mKIISKEFTVKTRSRFDSIDITEQVSEAIKGINNGIAHVIVKHTTCAIIINEAESGLmKDFLNWAKKLVPPDGEFEHNIIDNNGHAHVISAIIGNSRVVPIIEGKLDLGTWQRIILLEFDGPRTRTVLVKSmGE 134 | 10 20 30 40 50 |60 70 80 90 100 110 120 130 | | 58-MSE 132-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (Q96YV5_SULTO | Q96YV5)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|