|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1VD0) |
Sites (0, 0)| (no "Site" information available for 1VD0) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1VD0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1VD0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VD0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1VD0) |
Exons (0, 0)| (no "Exon" information available for 1VD0) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:109 aligned with DECO_LAMBD | P03712 from UniProtKB/Swiss-Prot Length:110 Alignment length:109 11 21 31 41 51 61 71 81 91 101 DECO_LAMBD 2 TSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV 110 SCOP domains d1vd0a_ A: automated matches SCOP domains CATH domains ------------------1vd0A01 A:19-109 [code=2.40.300.10, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------- Transcript 1vd0 A 1 TSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV 109 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1VD0) |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (DECO_LAMBD | P03712)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|